KEGG   Loxodonta africana (African savanna elephant): 100659666
Entry
100659666         CDS       T04351                                 

Gene name
ITPR3
Definition
(RefSeq) LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04114  Oocyte meiosis
lav04210  Apoptosis
lav04218  Cellular senescence
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04742  Taste transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100659666 (ITPR3)
   04020 Calcium signaling pathway
    100659666 (ITPR3)
   04070 Phosphatidylinositol signaling system
    100659666 (ITPR3)
   04022 cGMP-PKG signaling pathway
    100659666 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100659666 (ITPR3)
   04210 Apoptosis
    100659666 (ITPR3)
   04218 Cellular senescence
    100659666 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100659666 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100659666 (ITPR3)
   04621 NOD-like receptor signaling pathway
    100659666 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    100659666 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    100659666 (ITPR3)
   04922 Glucagon signaling pathway
    100659666 (ITPR3)
   04929 GnRH secretion
    100659666 (ITPR3)
   04912 GnRH signaling pathway
    100659666 (ITPR3)
   04915 Estrogen signaling pathway
    100659666 (ITPR3)
   04921 Oxytocin signaling pathway
    100659666 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    100659666 (ITPR3)
   04918 Thyroid hormone synthesis
    100659666 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    100659666 (ITPR3)
   04924 Renin secretion
    100659666 (ITPR3)
   04925 Aldosterone synthesis and secretion
    100659666 (ITPR3)
   04927 Cortisol synthesis and secretion
    100659666 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100659666 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    100659666 (ITPR3)
   04971 Gastric acid secretion
    100659666 (ITPR3)
   04972 Pancreatic secretion
    100659666 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100659666 (ITPR3)
   04725 Cholinergic synapse
    100659666 (ITPR3)
   04728 Dopaminergic synapse
    100659666 (ITPR3)
   04726 Serotonergic synapse
    100659666 (ITPR3)
   04720 Long-term potentiation
    100659666 (ITPR3)
   04730 Long-term depression
    100659666 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    100659666 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    100659666 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    100659666 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100659666 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100659666 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100659666 (ITPR3)
   05012 Parkinson disease
    100659666 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    100659666 (ITPR3)
   05017 Spinocerebellar ataxia
    100659666 (ITPR3)
   05020 Prion disease
    100659666 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    100659666 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100659666 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100659666 (ITPR3)
   05163 Human cytomegalovirus infection
    100659666 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100659666 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100659666 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659666 (ITPR3)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100659666 (ITPR3)
Ion channels [BR:lav04040]
 Ligand-gated channels
  IP3 receptor
   100659666 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 100659666
NCBI-ProteinID: XP_003421083
UniProt: G3TPV4
LinkDB
Position
Unknown
AA seq 2670 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGTGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGDGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPS
MLQAYDDSGGKNVRRSIQGVGHMMSTMVLSRKQSVFGAPNLPPGAGAAEPLDRSKFEENE
DIVVMETKLKTLEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGTAKDKKERPTDEEGFLHPHGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEIGEPVLQHFVHLLATHGRHVQYLDFLHTIIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLTHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FESFTLDMARVCSKREKRMSDPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSLLSSGISLAA
AAQRNVSNYKAATRSFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSSSRGDLSDPMGAGLDQDWSAISATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQET
KSTVTVNMSDLGNQPREDREPDPVAKGRVASFSMPGSPSRYSLGPSLRRGREVEERVQSN
EMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGG
LGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPL
CKYRVDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEEREN
SEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQMLK
SSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQ
DEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAF
FYPYVEGASTGVLGSPLMSLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGPT
LNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFY
SILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDR
LPSNDSKANPLGMPHSAAAFVGTCSRDKTDCVSGVSVPEVLEEDEEPDSTERACDTLLMC
IVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFA
DLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKT
DYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRLLQDKLNSTMKLVSHLTA
QLNELKEQMTEQRKRRQRLGFVDVQNCISR
NT seq 8013 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagctttctccatatcggggacattgtctctctgtacgccgagggc
tcggtcaatggcttcatcagcactttagggctggtggatgaccgctgtgtggtggagccc
gcggctggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcagcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagattgctgacgtggtgctgctgcagaagttgcagcatgcagcccagatggag
cagaagcagaacgacacggagaacaagaaggtgcatggggatgtcgtgaagtacggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgactgtgaacaagcggctgccg
gccctgctggagaagaatgccatgcgggtgacgctggacgccacgggcaacgagggctcc
tggctcttcatccagcccttctggaagctgcggagcaatggggacaatgtggtcgtgggg
gacaaggtgatcctgaaccctgtcaacgccgggcagcctctgcacgccagcaattacgag
ctcagtgacaatgctggctgcaaggaggtcaactctgtaaactgcaacaccagctggaag
atcaacctgttcatgcagttccgggaccacctggaggaggtgttgaaagggggagatgtg
gtgcggctgttccacgcagagcaggagaagttcctgacatgtgacgagtacaggggcaag
ctgcaggtgtttctgcgcaccacgcttcgccagtccgccacctcggccaccagctccaac
gccctctgggaggtggaggtggtccaccatgacccctgccgtggaggagctggccactgg
aatggcctgtaccgcttcaagcacctggccacaggcaactacctggctgctgaggagaac
cccagctacaagggcgatgcctcggatcccaaggcagcaggaacgggtgcccagggccgt
gcaggtcgcaggaacgctggggagaagatcaagtaccgcctggtggctgtgccccatgga
aacgacattgcctctctctttgagctggaccccaccactttgcagaaaactgactcattt
gtgccccggaactcgtacgtccgtctgcggcacctctgcaccaacacgtggatccagagc
acaaatgtgcccatcgacatcgaggaggaacggcccatcaggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcagtgcctgtgtccgagatccgc
gacctggactttgccaacgatgccagctccatgctggccagtgcggtggagaaactcaat
gagggcttcatcagccagaacgaccgcaggtttgtcatccagctgctggaggacctggtg
ttctttgtcagtgatgtccccaacaatgggcagaatgtcctggacatcatggtcaccaag
cccaaccgggaacggcagaagctgatgagggaacagaacatcctcaaacagatctttggc
attctgaaggccccgttccgcgacaaggggggtgatggccccctcgtgcggctggaagag
ctgtcagaccagaagaatgccccttatcagcatatgttccggctctgctaccgggtgctg
cggcattcccaggaggattaccggaagaaccaggaacacattgccaaacagtttgggatg
atgcagtcccagatcggctatgacatcctggccgaggacaccatcactgcccttctgcac
aacaaccgcaaacttctggagaagcacatcaccaagaccgaggtggagaccttcgtcagc
ctcgtgcgcaagaaccgggagcccaggttcctggactacctctccgacctgtgtgtgtcc
aaccacattgccattcccgtcacacaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccagaccgagcttcggccagtgaaggagatggcacagtcccat
gagtacctgagcatcgagtactcagaggaggaagtgtggctcacttggactgacaagaat
aatgagcaccatgagaagagtgtgaggcagctggcccaggaggcgcgggcaggcaatgcc
catgacgagaatgttctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccggcagtacctggccattgatgagatctcccagcagctgggtgttgacctgatc
ttcttgtgcatggcagacgagatgctgccctttgacctgcgtgcctccttctgccacctg
atgctgcatgtgcatgtggaccgtgacccccaggagctggtcacacccgtcaagttcgcc
cgcctctggactgagatcccaacggccatcaccatcaaggactatgattccaacctcaac
gcctcccgagatgacaagaagaacaagtttgccaacaccatggagtttgtggaggactac
ctcaacaacgtggtcagcgaggctgtgccctttgccaatgaggagaagaacaagctcacc
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagtttcagcgag
ctgctgcggctgacacgcacactgctgggcatcattgactgcgtgcagggtccaccatcc
atgctgcaggcctacgacgactcgggcggcaagaatgtgcggcggtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtctgtctttggcgcccccaac
ttgccccctggcgccggtgctgctgagcccctggatcgaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagaccctggaaatcctgcagttcatcctcaac
gtccgcctggattaccgcatctcctacctgctgtctgtcttcaagaaggagtttgtagag
gtgttccccatgcaggacagtggagctgacggcacggcccctgccttcgactccaccacc
gccaacatgaacctggatcgcattggggagcaggcggaagccatgtttggagtgggaaag
acaagcagcatgctggaggtggatgacgagggcggccgcatgttcctgcgtgtgcttatc
cacctcaccatgcacgactacgcaccgctggtctcgggcgccctgcagctgctcttcaaa
cacttcagccagcgccaggaggccatgcacaccttcaagcaggtacagctgctgatctcg
gcccaggatgtggagaactacaaggtaatcaagtcagagctggaccggctgcggactatg
gttgagaagtcggagctatgggtggacaaaaagggcagcggaaagggcgaggaggtagag
gcaggcaccgccaaagacaagaaggagcggcccacggatgaggagggctttctacaccca
catggggagaagagcagtgagaactaccagatcgtcaagggcatcctggagcggctgaat
aagatgtgtggcgttggggagcagatgaggaagaagcagcagcggttgctcaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctatgacaagggcgatgccaag
atgatggagatcctgcgctacacacaccagttcctgcagaagttctgcgcggggaacccc
ggcaaccaggccctgctgcacaagcacctgcacctcttcctcacaccggggctcctggag
gcagagaccatgcagcacatcttcttgaacaactaccagctgtgctctgagatcggcgag
cctgtgttgcagcacttcgtgcacctgctggccacgcatggccgccatgtgcagtacctg
gacttcttgcacaccatcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaatgacaaggcc
tcactgacccacctgctggacatgatgaaggcagcccgtgatggcgtggaggaccacagc
cctctcatgtaccacatctccctggtagacctgctggccgcctgtgccgagggcaagaac
gtctacactgaaatcaagtgcacctccctgctgcccctggaggacgtggtgtctgtggtg
acacatgaggactgcatcactgaggtgaaaatggcctacgtgaactttgtgaaccactgc
tatgtggacacagaggtggagatgaaggagatttacaccagcaaccacatctggaccctc
tttgagagcttcaccttggacatggctcgggtctgcagtaagcgggagaagcgcatgtct
gaccccaccctggagaagtatgtgctgaccgtcgtgctggacaccatcaacgccttcttc
agctctccattctctgagaacagcacctccctgcagacacaccagacaattgtggtgcag
ctgctgcagtccaccacgcggctgctggagtgcccatggctgcaacagcagcacaagggc
tccgtggaggcctgcatccgaaccctcgccatggtggccaagggtcgggccatcttgctg
cccatggacctggatgcccacatcagctcgctgctcagcagtggaatcagccttgccgca
gctgcccagcggaacgtttccaactacaaggcggccacccggtccttcccccgtgtcacc
cccactgctaaccagtgggactacaagaacatcattgagaagctacaggacatcatcacg
gccctggaggagcggctgaagccgctggtgcaggccgagctgtctgtgctggtggatgtg
ctgcactggcccgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagc
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtctgaggagaag
ctgtgcatcaaggtgctgcggaccctgcaacaaatgctgctcaagaagaccaagtacggg
gaccggggcaaccagctgcgcaagatgctgctacagaactatctccagaaccggaagtct
agttcacggggagacctgtcggaccccatgggtgctggcctggaccaggactggtcagca
atctcggccacccagtgccggctggacaaggaaggggccaccaagctggtgtgtgacctc
atcaccagcaccaagaatgagaagatcttccaggagagcattggcctggccatccgcctg
ctggatggtggcaacactgagatccagaaatccttctacaacctgatgacgagcgacaag
aagtccgagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacagtgactgtcaacatgagtgacctgggcaaccagcctcgtgaggatcgtgag
ccagaccctgttgccaaaggccgcgtggcctccttctccatgcctggctccccatcccgc
tattcgctgggccccagcctgcgccgggggcgtgaggtggaggagcgcgtgcagagcaat
gagatgggcacgtccgtgctcatcatgcagccgatcctgcgcttcctgcagctgctgtgc
gagaaccacaaccgggacctgcagaacttccttcgctgtcagaacaacaagaccaactac
aacctggtgtgtgaaacgctgcagttcctggacatcatgtgtggcagcacgacgggtggc
ctagggctgctagggctctacatcaatgaggacaatgtgggcctcgtcatccagactctg
gagaccctcactgagtactgccagggcccctgccatgagaaccagacctgcatcgtgaca
catgagtccaatggcatagacatcatcactgcactgattctcaatgacatcagccccctg
tgcaagtaccgcgtggatttagtgctgcagctcaaggacaatgcctctaagctgctcctg
gctctgatggaaagccggcatgacagtgaaaatgctgagcgcattctcattagcctgcgg
ccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaagagagggaaaac
tcggaggtgagcccacgggaagtgggccataacatctacatcctggcactgcagctctcc
aggcacaacaaacagctgcagcacctgctgaagcctgtgaagcgcatccaagaggaggag
gccgagggcatctcttccatgctcagcctcaacaacaagcagctgtctcagatgctcaag
tcatcggctccggcacaggaggaggaggaggaccccctggcctactacgagaaccacacg
tcccagattgagatcgtgcggcaggaccgcagcatggagcagatcgtgttcccggtgcct
ggcatctgccagttcctgacggaggagaccaagcaccggctcttcaccaccactgagcag
gacgagcagggcagcaaagtgagcgactttttcgaccagtcctccttcctgcacaacgag
atggagtggcagcggaagctccgcagcatgccattgatctactggttctcccgccgcatg
accctgtgggggagcatctccttcaacctggccgttttcatcaacatcatcattgccttc
ttctacccgtatgtggagggcgcatccacaggcgtgctgggctccccgctcatgtctctg
ctgttttggatcctcatctgcttctccattgcggccctgttcaccaagcgctacagcatc
cgccccctcatcgtggcgctcatcctgcgttccatctactacctgggcatcgggcccacg
ctcaacatcctgggcgccctcaatctgaccaacaagatcgtgttcgttgtgagcttcgtg
ggcaaccgtggcaccttcatccgtggttataaggccatggtcatggacatggaattcctc
taccacgtgggctacatcctcactagtgtcctgggcctcttcgcacacgaactcttctac
agcatcctgctctttgacctcatctaccgtgaggagaccctattcaacgtcatcaagagt
gtgacccgcaatggccgctccatcctgctgaccgccctgctggccctcatcctggtctac
ctcttctccatcgtgggcttcctcttcctgaaggatgacttcatccttgaggttgaccgg
ctgcccagcaacgactccaaagccaaccccctggggatgccacatagtgctgccgcattt
gtgggcacatgcagcagggacaagacggactgtgtctcgggggtctcagtgcctgaggtc
ctggaagaggacgaggagccagacagcacggagcgggcgtgtgacacgctgctgatgtgc
attgtcaccgtcatgaaccatgggctgcgcaacgggggtggcgtgggcgacattctccgc
aagccctccaaagatgagtctctcttcccagcccgcgtggtctatgacctcctattcttc
ttcatcgtcatcatcattgtgctgaacctcatctttggggtgatcattgacacctttgcc
gatctgcgcagtgagaagcagaagaaggaggagattctcaagacaacatgcttcatctgt
ggtctggagagggacaagtttgataacaagactgtgtcatttgaggagcacatcaagctg
gagcataacatgtggaactacctgtacttcatcgtgctagtccgggtgaagaacaagacg
gactacacaggccccgagagctacgtggcccagatgatcaagaacaagaatctggactgg
ttccccaggatgagggccatgtccctggtgagcaacgagggtgagggggaacagaacgag
atccggctccttcaggacaagctcaactccaccatgaagctggtgtcacacctcactgcc
cagctcaatgagctcaaggagcagatgacggaacagaggaaacgcaggcaacgcctgggc
ttcgtggatgtgcagaactgcatcagccgctga

DBGET integrated database retrieval system