KEGG   Loxodonta africana (African savanna elephant): 100659681
Entry
100659681         CDS       T04351                                 

Gene name
HRH2
Definition
(RefSeq) histamine H2 receptor isoform X1
  KO
K04150  histamine receptor H2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100659681 (HRH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659681 (HRH2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100659681 (HRH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100659681 (HRH2)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    100659681 (HRH2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100659681
NCBI-ProteinID: XP_010590987
UniProt: G3SUW5
LinkDB
Position
Unknown
AA seq 416 aa
MAPSDTPSSIASKITISVVLTILILITVAGNVIVCLAVGLNRRLRSLTNCFIVSLAITDL
LLGLLVLPFSAIYQLSCNWSFGQIFCNIYTSLDVMLCTASILNLFMISLDRYCAVTDPLR
YPVLVTPVRVTISLVFIWVISITLSFLSIHLGWNSRNKTIGSNHTTSQCKVQVNEVYGLV
DGLVTFYLPLLIMCVTYYRIFKIARDQAKRINHISSWNSATIKEHKATVTLAAVMGAFII
CWFPYFTVFVYRGLRGDEAINEVIEAIVLWLGYANSALNPILYAALNRDFRTAYQQLFCC
RSTSHNSRDTSLRFTDSQVSRSESRNHKGQEEKPLKLQVWSGTEVTAPQGATDRKPALPC
TLCSSNLLSCCKSLWGLQFLQRHLGAPAEEQLGEPLSEEPLRTLPTEAVRMLLQNR
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcgcccagtgacacaccctcttccatcgcatccaagatcaccattagtgtggtcctc
accatccttatcctcatcactgttgctggcaatgtgattgtctgcctggctgtgggcttg
aaccgccggctccgcagcctgaccaactgcttcatcgtgtccttagccatcactgacctg
ctccttggcctcctggtgcttcccttctctgccatctaccagctgtcctgcaactggagc
ttcggccagatcttctgcaacatctacaccagcctggacgtgatgctctgcacagcctca
atcctcaacctctttatgatcagccttgaccggtactgtgctgtcacagacccgctccgc
tacccggtactggtcacccctgtgagggtcaccatctccctggtctttatttgggtcatc
tccatcactctatccttcctgtctattcacctggggtggaatagcaggaacaagaccatc
ggtagcaaccataccacttctcagtgcaaagttcaggtcaatgaagtatatggcttggtg
gatgggctggtcaccttctacctgcctctgctcatcatgtgtgttacctactaccgcatc
ttcaagattgcccgggaccaggccaagaggatcaatcacatcagctcctggaactcggcc
actatcaaggagcacaaagccacagtgaccttggctgctgtgatgggggccttcattatc
tgctggttcccctacttcaccgtgtttgtctaccgtgggctcagaggggacgaggccatc
aatgaggtcattgaagcaattgttctgtggctgggctatgccaactcagccctgaacccc
atcctgtacgcggcattgaacagagacttccgcaccgcataccagcagcttttctgctgc
agatccaccagccacaactcccgagacacttctctgaggtttaccgactctcaggtgtcc
aggagcgaaagcagaaaccacaaggggcaggaagagaagcccctgaagctacaggtgtgg
agtgggactgaggttacggccccacagggagcaacagacaggaagccagcactgccctgc
accctgtgctccagcaacctcctgagctgctgcaagagcctgtgggggcttcagttcctt
cagaggcacctgggagcccccgcagaggagcagttgggggagccactgtctgaggagcca
ctgaggacactgcccacggaagcagtgaggatgctgctccagaaccgctga

DBGET integrated database retrieval system