KEGG   Loxodonta africana (African savanna elephant): 100659799Help
Entry
100659799         CDS       T04351                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04910  Insulin signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
Module
lav_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100659799 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100659799 (GYS1)
   04152 AMPK signaling pathway
    100659799 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100659799 (GYS1)
   04922 Glucagon signaling pathway
    100659799 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100659799 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lav01003]
    100659799 (GYS1)
Enzymes [BR:lav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100659799 (GYS1)
Glycosyltransferases [BR:lav01003]
 Polysaccharide
  Storage polysaccharide
   100659799 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100659799
NCBI-ProteinID: XP_003406867
UniProt: G3SZN0
LinkDB All DBs
Position
Unknown
AA seq 737 aa AA seqDB search
MPLSRSLSVSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTLGLKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDSLPDEDGERYDEEEEAAKDRRNIRTPEWQRRSSSASSTGGSKRSSVDTAPSSTVS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgccgctaagccgcagtttgtccgtgtcctcactgccaggactggaggattgggaggat
gaattcgacctggagaacacggtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggccaaggtgacaggggatgagtggggtgac
aactactacctcgtgggaccatacacggagcagggagtgaggacccaggtagaactgctt
gagccccccaccctgggcctgaagaggaccctggactccatgaacagcaaaggctgcaag
gtgtattttgggcgctggctgatcgagggaggccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccatggtatgaccgtgaggccaatgatgctgtcctctttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttgcgcactttcac
gagtggttggcgggtgtagggctttgcctgtgccgagcccggcggctgcccgtggctacc
atcttcaccacccatgccacgctgctgggacgttacctgtgtgccggtgctgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaagcaggtgagaggcagatttatcac
cgctactgcatggagcgggcagctgcccactgtgctcacgtcttcactactgtgtcccag
atcactgccatcgaggcacagcacctactcaagaggaaaccagatattgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaaccttcatgcccagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttattgctggccgctacgaattctccaacaagggggctgac
gtcttcctggaggccttggccaggctcaactatctgctcagagtgaatggcagtgaacag
acagtggtcgccttcttcatcatgccggctcggaccaataatttcaatgtggaaaccctc
aagggccaagccgtccgcaagcagctttgggacacagccaacacagtgaaagagaaattc
gggaggaagctttatgagtccttgctggtggggagtctcccagatatgaacaaaatgctg
gacaaggaggacttcacaatgatgaagagagccatctttgccacgcagcggcagtccttc
ccccctgtgtgcacccacaatatgctggatgactcatcggaccctatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtcaaggtgattttccacccagag
ttcctttcctccacgagccccctgcttcctgtggactatgaggagtttgtccgaggctgc
caccttggggttttcccctcttactatgagccttggggctatacaccagctgagtgtacc
gttatgggcatccccagtatctccacaaacctctccggcttcggctgcttcatggaggag
cacatcgcagacccatcagcttatggcatctatattctggaccggcggttccgcagcctg
gacgattcgtgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcggaatcgcacagagcgcctctccgaccttctggattggaaatac
ctaggccggtactatatgtccgcgcgccacatggccctggccaaggcctttccggatcac
ttcacctacgagccccacgaggcagatgcggcccagggctaccgctacccacggccggcc
tcagtgccgccgtctccctcgctgtcacgacactcgagcccacaccagagcgaagatgag
gaggaaccccgcgactcgctgccggatgaggacggggagcgctacgacgaggaggaggag
gctgccaaagacaggcgcaacatccgcacccctgagtggcagcggcgctcctcttccgcc
tcttctactggagggagcaagcgcagctcagtggacacagcgccctccagcactgtcagc
acccccagcgagcccctcagccccgccagctccctgggcgaggaacgcaactag

DBGET integrated database retrieval system