KEGG   Loxodonta africana (African savanna elephant): 100659862Help
Entry
100659862         CDS       T04351                                 

Definition
(RefSeq) cationic trypsin-3-like
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100659862
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100659862
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100659862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100659862
NCBI-ProteinID: XP_003420296
UniProt: G3TM62
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKELIFLTLLGAAVVFSSDDDDKIVGGYTCQKNSIPYQVSLNSGYHFCGGALISDQWVLS
AAHCYKSQIQVRLGEHNIEVLEGNEQFIKAAKIIRHPNYNSGTYDNDILLIKLSSAASIN
SRVATVSLPRSVAAVGTQCLISGWGNTLSSGTNYPDLLQCLNAPILSDSVCHSAYPGKIT
SNMICLGFLEGGKDSCQGDSGGPVVCNGALQGIVSWGYGCALEGKPGVYTKVYNYLSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctcatcttcctcactctcctgggagcggctgttgttttctccagtgatgat
gacgacaagatagttgggggctacacctgtcagaagaattctatcccttaccaggtgtca
ttgaactcgggctatcacttctgtggtggtgccctcatcagtgaccagtgggtgttgtct
gcggctcactgctacaagtcccaaattcaggtgcgtctgggagaacacaacattgaggtc
cttgagggtaatgagcagttcattaaagcggccaagatcatccgccaccccaattacaat
tcaggcacctatgataatgacatcttgctgattaaactgagctctgcagctagcatcaac
tctcgtgtggccacagtctctctgccaaggtctgtggctgccgtcggcacccaatgcctc
atctccggctggggcaacaccctaagcagtggcacaaactacccagacctcttgcagtgt
ctgaacgcccccatcctctctgacagtgtctgccacagtgcctacccaggcaagatcacc
agcaacatgatttgtctgggcttcctggagggtggcaaggactcttgccagggtgactct
ggcggtcccgtagtctgcaatggagcacttcagggcatcgtctcctggggctacggctgt
gctctggaaggcaaacccggcgtctacaccaaggtctacaactacctgagctggattcag
cagaccatcgctgccaactag

DBGET integrated database retrieval system