KEGG   Loxodonta africana (African savanna elephant): 100659862Help
Entry
100659862         CDS       T04351                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04972  Pancreatic secretion
lav04974  Protein digestion and absorption
lav05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100659862
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100659862
   04974 Protein digestion and absorption
    100659862
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100659862
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100659862
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659862
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100659862
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100659862
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100659862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100659862
NCBI-ProteinID: XP_003420296
UniProt: G3TM62
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKELIFLTLLGAAVVFSSDDDDKIVGGYTCQKNSIPYQVSLNSGYHFCGGALISDQWVLS
AAHCYKSQIQVRLGEHNIEVLEGNEQFIKAAKIIRHPNYNSGTYDNDILLIKLSSAASIN
SRVATVSLPRSVAAVGTQCLISGWGNTLSSGTNYPDLLQCLNAPILSDSVCHSAYPGKIT
SNMICLGFLEGGKDSCQGDSGGPVVCNGALQGIVSWGYGCALEGKPGVYTKVYNYLSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctcatcttcctcactctcctgggagcggctgttgttttctccagtgatgat
gacgacaagatagttgggggctacacctgtcagaagaattctatcccttaccaggtgtca
ttgaactcgggctatcacttctgtggtggtgccctcatcagtgaccagtgggtgttgtct
gcggctcactgctacaagtcccaaattcaggtgcgtctgggagaacacaacattgaggtc
cttgagggtaatgagcagttcattaaagcggccaagatcatccgccaccccaattacaat
tcaggcacctatgataatgacatcttgctgattaaactgagctctgcagctagcatcaac
tctcgtgtggccacagtctctctgccaaggtctgtggctgccgtcggcacccaatgcctc
atctccggctggggcaacaccctaagcagtggcacaaactacccagacctcttgcagtgt
ctgaacgcccccatcctctctgacagtgtctgccacagtgcctacccaggcaagatcacc
agcaacatgatttgtctgggcttcctggagggtggcaaggactcttgccagggtgactct
ggcggtcccgtagtctgcaatggagcacttcagggcatcgtctcctggggctacggctgt
gctctggaaggcaaacccggcgtctacaccaaggtctacaactacctgagctggattcag
cagaccatcgctgccaactag

DBGET integrated database retrieval system