KEGG   Loxodonta africana (African savanna elephant): 100659905
Entry
100659905         CDS       T04351                                 

Gene name
SIVA1
Definition
(RefSeq) apoptosis regulatory protein Siva
  KO
K22744  apoptosis regulatory protein Siva
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100659905 (SIVA1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 100659905
NCBI-ProteinID: XP_023402378
LinkDB
Position
Unknown
AA seq 126 aa
MDHVWDEGSPESCTLVHLPESPKPSPTGVPGVTSGQMLIGPGGRLLRSHVQASGADPSEA
ASRACSSCVRSVDGKAVCSQCERPLCGRCLRTCWGCGAVACALCSAVDYGDVHEKALCTS
CAMFEA
NT seq 381 nt   +upstreamnt  +downstreamnt
atggaccatgtgtgggatgaaggttcgccagagagctgcacccttgtccacctgcctgag
tccccgaagcccagccccacaggtgtcccaggggtcaccagtgggcagatgctgatcgga
ccgggtggccgcctgctgaggagccatgtccaggcctcaggggccgacccatcggaggca
gcgtccagggcctgctcctcgtgcgttcgcagtgtggacggaaaggcggtctgcagccag
tgtgagcgccccctgtgtggtcggtgtctgcgcacctgctggggctgcggcgccgtggcc
tgtgccctgtgctccgctgttgactatggtgacgttcatgagaaggcactctgcaccagc
tgcgccatgtttgaagcgtga

DBGET integrated database retrieval system