KEGG   Loxodonta africana (African savanna elephant): 100659984
Entry
100659984         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100659984
   04151 PI3K-Akt signaling pathway
    100659984
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100659984
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100659984
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100659984
   04621 NOD-like receptor signaling pathway
    100659984
   04622 RIG-I-like receptor signaling pathway
    100659984
   04623 Cytosolic DNA-sensing pathway
    100659984
   04650 Natural killer cell mediated cytotoxicity
    100659984
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659984
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100659984
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100659984
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100659984
   05161 Hepatitis B
    100659984
   05160 Hepatitis C
    100659984
   05171 Coronavirus disease - COVID-19
    100659984
   05164 Influenza A
    100659984
   05162 Measles
    100659984
   05168 Herpes simplex virus 1 infection
    100659984
   05163 Human cytomegalovirus infection
    100659984
   05167 Kaposi sarcoma-associated herpesvirus infection
    100659984
   05169 Epstein-Barr virus infection
    100659984
   05165 Human papillomavirus infection
    100659984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100659984
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100659984
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100659984
NCBI-ProteinID: XP_003407699
LinkDB
Position
Unknown
AA seq 196 aa
MAFSFLLLIALVVLSCNSTCSLGCDLPQSHSLANRRTMILLGQMRRISPFSCLKDRNDFG
FPQEELDGNKFQKTQAISVHHEIIQQLFNLFSLQASSAAWDKTLLDKLYTGLYQQLNDLE
VCLMKEMGIEETALLLINEDSMLAVRKYFQRITVYLTEKKYSPCAWEIVRAEIMSSFSVS
TNWQERLRSKEGDHIL
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccttctctttccttttgctgatcgccctggtggtgctcagctgcaactccacctgc
tctctgggctgtgacctgcctcagagccatagcctggctaacaggagaaccatgatactt
ctgggacaaatgaggagaatctcccctttctcctgcctgaaggacagaaatgactttggg
tttccccaggaggagcttgatggcaacaagttccagaagactcaagccatctctgtccac
catgaaataatccaacagctcttcaacctcttcagcctacaggcctcatctgctgcctgg
gataagaccctcctggacaaattgtacactggactctatcagcagctgaatgacctggaa
gtctgtttgatgaaggagatggggatagaagaaactgccctcctcctgataaacgaggac
tccatgctggctgtgaggaagtacttccaaagaatcactgtctatctgacagagaagaaa
tacagcccttgtgcctgggagattgtcagagcagaaatcatgagctccttctctgtatca
acaaactggcaagaaaggctaagaagtaaggaaggtgaccacatcctataa

KEGG   Loxodonta africana (African savanna elephant): 100660270
Entry
100660270         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100660270
   04151 PI3K-Akt signaling pathway
    100660270
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100660270
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100660270
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100660270
   04621 NOD-like receptor signaling pathway
    100660270
   04622 RIG-I-like receptor signaling pathway
    100660270
   04623 Cytosolic DNA-sensing pathway
    100660270
   04650 Natural killer cell mediated cytotoxicity
    100660270
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660270
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100660270
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100660270
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100660270
   05161 Hepatitis B
    100660270
   05160 Hepatitis C
    100660270
   05171 Coronavirus disease - COVID-19
    100660270
   05164 Influenza A
    100660270
   05162 Measles
    100660270
   05168 Herpes simplex virus 1 infection
    100660270
   05163 Human cytomegalovirus infection
    100660270
   05167 Kaposi sarcoma-associated herpesvirus infection
    100660270
   05169 Epstein-Barr virus infection
    100660270
   05165 Human papillomavirus infection
    100660270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100660270
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100660270
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100660270
NCBI-ProteinID: XP_003407700
LinkDB
Position
Unknown
AA seq 196 aa
MAFSFLLLTALVVLSCNSTCSLGCDLPQSHSLANRRTIVLLGQMRRISPFSCLKDRNDFG
FLQEELDGNKFQKAQAISVHHEMIQQIFNLFSLQVSSAAWDQTLLDKLYTGLYQQLNDLE
VCLMKEMGVEETPVLLMNEDSMLAVRKYFQRITVYLTEKKYSPCAWEIVRAEIMSSFSAS
TNWQERLRSKEGDLVP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccttctctttccttttgctgaccgccctggtggtgctcagctgcaactccacctgc
tctctgggctgtgacctgcctcagagccatagcctggctaacagaagaaccatagtgctt
ctgggacaaatgaggagaatctcccctttctcctgcctgaaggacagaaacgactttgga
tttctccaggaggagcttgatggcaacaagttccagaaggctcaagccatttctgtccac
catgagatgatccagcagatcttcaatctcttcagcctacaggtctcatctgctgcctgg
gatcagaccctcctggacaaattgtacactggactctatcagcagctgaatgacctggaa
gtctgtttgatgaaggagatgggcgtagaagaaactcctgtactcctgatgaacgaggac
tccatgctggctgtgaggaagtacttccaaagaatcactgtctatctgacagagaagaaa
tacagcccttgtgcctgggagatcgtcagagcagaaatcatgagctccttctctgcatca
acaaactggcaagaaagactaagaagcaaggaaggtgacctggtcccataa

KEGG   Loxodonta africana (African savanna elephant): 100660554
Entry
100660554         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100660554
   04151 PI3K-Akt signaling pathway
    100660554
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100660554
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100660554
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100660554
   04621 NOD-like receptor signaling pathway
    100660554
   04622 RIG-I-like receptor signaling pathway
    100660554
   04623 Cytosolic DNA-sensing pathway
    100660554
   04650 Natural killer cell mediated cytotoxicity
    100660554
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660554
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100660554
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100660554
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100660554
   05161 Hepatitis B
    100660554
   05160 Hepatitis C
    100660554
   05171 Coronavirus disease - COVID-19
    100660554
   05164 Influenza A
    100660554
   05162 Measles
    100660554
   05168 Herpes simplex virus 1 infection
    100660554
   05163 Human cytomegalovirus infection
    100660554
   05167 Kaposi sarcoma-associated herpesvirus infection
    100660554
   05169 Epstein-Barr virus infection
    100660554
   05165 Human papillomavirus infection
    100660554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100660554
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100660554
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100660554
NCBI-ProteinID: XP_023401100
LinkDB
Position
Unknown
AA seq 153 aa
MRRISPFSCLKDRNDFGFPQEELDGNKFQKTQAISVHHEIIQQLFNLFSLQASSAAWDKT
LLDKLYTGLYQQLNDLEVCLMKEMGIEETALPLINEDSMLAVRKYFQRITVYLTEKKYSP
CAWEIVRAEIMSSFSASTNWQERLRSKEVDLVP
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaggagaatctcccctttctcctgcctgaaggacagaaacgactttggatttccccag
gaggagcttgatggcaacaagttccagaagactcaagccatctctgtccaccatgaaata
atccaacagctcttcaacctcttcagcctacaggcctcatctgctgcctgggataagacc
ctcctggacaaattgtacactggactctatcagcagctgaatgacctggaagtctgtttg
atgaaggagatggggatagaagaaactgccctccccttgataaacgaggactccatgctg
gctgtgaggaagtacttccaaagaatcactgtctatctgacagagaagaaatacagccct
tgtgcctgggagattgtcagagcagaaatcatgagctccttctctgcatcaacaaactgg
caagaaaggctaagaagtaaggaagtcgacctggtcccataa

KEGG   Loxodonta africana (African savanna elephant): 100661135
Entry
100661135         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100661135
   04151 PI3K-Akt signaling pathway
    100661135
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100661135
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100661135
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100661135
   04621 NOD-like receptor signaling pathway
    100661135
   04622 RIG-I-like receptor signaling pathway
    100661135
   04623 Cytosolic DNA-sensing pathway
    100661135
   04650 Natural killer cell mediated cytotoxicity
    100661135
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661135
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100661135
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100661135
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100661135
   05161 Hepatitis B
    100661135
   05160 Hepatitis C
    100661135
   05171 Coronavirus disease - COVID-19
    100661135
   05164 Influenza A
    100661135
   05162 Measles
    100661135
   05168 Herpes simplex virus 1 infection
    100661135
   05163 Human cytomegalovirus infection
    100661135
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661135
   05169 Epstein-Barr virus infection
    100661135
   05165 Human papillomavirus infection
    100661135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100661135
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100661135
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100661135
NCBI-ProteinID: XP_023401101
LinkDB
Position
Unknown
AA seq 196 aa
MAFSFLLLIALVVLSCNSTCSLGCDLPQSHSLANRRTTMLLEQMRRVSTFSCLKDRNDFA
FPQEELDGNKFQKAQAISVHHEMIQQIFNLFSLQASSAAWDHSLLDKLFPALDQQLNDLE
VCLMKEMGIEETVLPLINEDSMLAVRMYFQRITVYLTEKKYSPCAWEIVRAEIMRSFSAT
TNWQKRLRSKEGHLVP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccttctctttccttttgctgatcgccctggtggtgctcagctgcaactccacctgc
tctctgggctgtgacctgcctcagagccatagcctggctaacaggagaaccacgatgctt
ctggaacaaatgaggagagtctccactttctcctgcttgaaggacagaaatgacttcgca
tttccccaggaggagcttgatggcaacaaattccagaaggctcaagccatctctgtccac
catgagatgatccagcagatcttcaacctcttcagcctacaggcctcctctgctgcctgg
gatcacagcctcctggacaaattgttccctgcacttgatcagcagctgaatgacctagaa
gtctgtttgatgaaggagatggggatagaagaaactgtcctccccctgataaatgaggat
tccatgctggctgtgaggatgtacttccaaagaatcactgtctatctaacagagaagaaa
tatagcccttgtgcctgggagattgtcagagcagaaatcatgagatccttctctgcaaca
acaaattggcaaaagaggttaagaagtaaggaaggccacctggttccataa

KEGG   Loxodonta africana (African savanna elephant): 100661986
Entry
100661986         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100661986
   04151 PI3K-Akt signaling pathway
    100661986
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100661986
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100661986
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100661986
   04621 NOD-like receptor signaling pathway
    100661986
   04622 RIG-I-like receptor signaling pathway
    100661986
   04623 Cytosolic DNA-sensing pathway
    100661986
   04650 Natural killer cell mediated cytotoxicity
    100661986
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661986
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100661986
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100661986
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100661986
   05161 Hepatitis B
    100661986
   05160 Hepatitis C
    100661986
   05171 Coronavirus disease - COVID-19
    100661986
   05164 Influenza A
    100661986
   05162 Measles
    100661986
   05168 Herpes simplex virus 1 infection
    100661986
   05163 Human cytomegalovirus infection
    100661986
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661986
   05169 Epstein-Barr virus infection
    100661986
   05165 Human papillomavirus infection
    100661986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100661986
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100661986
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100661986
NCBI-ProteinID: XP_003407703
LinkDB
Position
Unknown
AA seq 196 aa
MAFSFLLLMVLVVVSCNSTCSLGCDLPRSHSLDNRRTMMLLGQMRRISPLSCLKDRNDFG
FPQEELEGNKFQKAQAISVHHEIIQQIFSLFSLQASSAAWDQTLLDKLFAALDQQLNDLE
VCLMQEMGIEETSFPLINEDSMLAVRKYFQRITVYLTEKKYNPCAWEIVRAEIMSSFCAS
TNWQERLRSKEGDLVP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccttctctttccttttgctgatggtcctggtggtggtcagctgcaactccacctgc
tctctgggctgtgacctgcctcggagccatagcctggataacaggagaaccatgatgctt
ctgggacaaatgaggagaatctcccctttgtcctgcctgaaggacagaaatgactttggg
tttccccaggaggagcttgagggcaacaagttccagaaggctcaagccatctctgtccac
catgaaataatccaacagatcttcagtctcttcagcctgcaggcctcatctgctgcctgg
gatcagaccctcctggacaaattgttcgctgcacttgatcagcagctgaatgacctagaa
gtctgtttgatgcaggagatggggatagaagaaacttccttccccctgataaatgaggac
tccatgctggctgtgaggaagtacttccaaagaatcactgtctatctgacagagaagaaa
tacaacccttgtgcctgggagattgtcagagcagaaatcatgagctccttctgtgcatca
acaaactggcaagaaagactaagaagtaaggaaggcgacctggtgccataa

KEGG   Loxodonta africana (African savanna elephant): 100662831
Entry
100662831         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100662831
   04151 PI3K-Akt signaling pathway
    100662831
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100662831
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100662831
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100662831
   04621 NOD-like receptor signaling pathway
    100662831
   04622 RIG-I-like receptor signaling pathway
    100662831
   04623 Cytosolic DNA-sensing pathway
    100662831
   04650 Natural killer cell mediated cytotoxicity
    100662831
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662831
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100662831
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100662831
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100662831
   05161 Hepatitis B
    100662831
   05160 Hepatitis C
    100662831
   05171 Coronavirus disease - COVID-19
    100662831
   05164 Influenza A
    100662831
   05162 Measles
    100662831
   05168 Herpes simplex virus 1 infection
    100662831
   05163 Human cytomegalovirus infection
    100662831
   05167 Kaposi sarcoma-associated herpesvirus infection
    100662831
   05169 Epstein-Barr virus infection
    100662831
   05165 Human papillomavirus infection
    100662831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100662831
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100662831
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100662831
NCBI-ProteinID: XP_003407706
LinkDB
Position
Unknown
AA seq 196 aa
MAFSFLLLMALAVLSCNSICSLSCDLPQSHRLANRRTLILLEQMRRISPSSCLKDRNDFG
FPQEELEGNKFQKAQAISVHHEMIQQIFNLFSLQASSAAWDQTLLDKLFAALDQQLNDLE
VCLMQETGVEETPVPVINEDSMLAVRKYFQRITVYLTEKKYSPCAWEIVRAEIMRSFSAS
TNWQERLRSKEGDLVP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccttctctttccttttactgatggccctggcggtgctcagctgcaactccatctgc
tctctgagctgtgacctgcctcagagccatagactggctaacaggagaaccttgattctt
ctggaacaaatgagaagaatctccccttcttcctgcttgaaggacagaaatgactttgga
tttccccaggaggagcttgagggcaacaagttccagaaggctcaagccatctctgtccac
catgagatgatccagcagatcttcaacctcttcagcctacaggcctcatctgctgcctgg
gatcagaccctcctggacaaattgttcgctgcacttgatcagcagctgaatgacctggaa
gtctgtttgatgcaggagacgggggtagaagaaactcccgtacctgtgataaatgaggac
tccatgctggctgtgaggaaatacttccaaagaatcactgtctatctgacagagaagaaa
tacagcccctgtgcctgggagattgtcagagcagaaatcatgcgctccttctctgcatca
acaaattggcaagaaaggctaagaagtaaggaaggcgacctggttccataa

KEGG   Loxodonta africana (African savanna elephant): 100663685
Entry
100663685         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-6-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100663685
   04151 PI3K-Akt signaling pathway
    100663685
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100663685
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100663685
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100663685
   04621 NOD-like receptor signaling pathway
    100663685
   04622 RIG-I-like receptor signaling pathway
    100663685
   04623 Cytosolic DNA-sensing pathway
    100663685
   04650 Natural killer cell mediated cytotoxicity
    100663685
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663685
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100663685
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100663685
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100663685
   05161 Hepatitis B
    100663685
   05160 Hepatitis C
    100663685
   05171 Coronavirus disease - COVID-19
    100663685
   05164 Influenza A
    100663685
   05162 Measles
    100663685
   05168 Herpes simplex virus 1 infection
    100663685
   05163 Human cytomegalovirus infection
    100663685
   05167 Kaposi sarcoma-associated herpesvirus infection
    100663685
   05169 Epstein-Barr virus infection
    100663685
   05165 Human papillomavirus infection
    100663685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100663685
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100663685
SSDB
Motif
Pfam: Interferon Peptidase_C6
Other DBs
NCBI-GeneID: 100663685
NCBI-ProteinID: XP_010586204
LinkDB
Position
Unknown
AA seq 172 aa
MALPISVLMALVMFCCRPACFWCCDLPLSHSNQETFTLLNQMERISLLSCLKDRTDFRFP
QILMDMNQLEKTQAAVLLYEMLQQTFNLFSRSDSLEAWDETFLDKFLLGLYQQLNDLEIC
FEKERKVEQIPLGTENSVKSYFQGIGLYLKEKEHSLCVGGCQSGNQKMLSLH
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccctcccaatctctgtgctgatggccctggtgatgttctgctgcagacctgcctgc
ttttggtgctgtgacctacctctgagccatagcaatcaggaaaccttcacacttttgaat
caaatggagagaatctcccttctgtcatgtctgaaggacaggactgatttcagatttcct
cagatacttatggatatgaaccagctggaaaagacgcaagctgctgttctcctgtatgag
atgcttcagcaaaccttcaacctcttcagcagaagtgactctcttgaggcttgggatgag
acctttctggacaaattcctgcttggactttatcagcagttgaatgacctggagatctgt
ttcgagaaagaaaggaaggtggaacagatacccctgggaactgagaactctgtgaagagt
tacttccaaggaatcggtctgtatctgaaagaaaaggaacacagcctctgtgtgggaggt
tgtcagagtggaaatcagaaaatgctttctcttcattaa

KEGG   Loxodonta africana (African savanna elephant): 100665583
Entry
100665583         CDS       T04351                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100665583
   04151 PI3K-Akt signaling pathway
    100665583
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100665583
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100665583
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100665583
   04621 NOD-like receptor signaling pathway
    100665583
   04622 RIG-I-like receptor signaling pathway
    100665583
   04623 Cytosolic DNA-sensing pathway
    100665583
   04650 Natural killer cell mediated cytotoxicity
    100665583
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665583
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100665583
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100665583
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100665583
   05161 Hepatitis B
    100665583
   05160 Hepatitis C
    100665583
   05171 Coronavirus disease - COVID-19
    100665583
   05164 Influenza A
    100665583
   05162 Measles
    100665583
   05168 Herpes simplex virus 1 infection
    100665583
   05163 Human cytomegalovirus infection
    100665583
   05167 Kaposi sarcoma-associated herpesvirus infection
    100665583
   05169 Epstein-Barr virus infection
    100665583
   05165 Human papillomavirus infection
    100665583
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100665583
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interferons
   100665583
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100665583
NCBI-ProteinID: XP_003407381
LinkDB
Position
Unknown
AA seq 196 aa
MAFSFLLLIALVVLSCNSTCSLGCDLPQSHSLANRRTMMLLGQMRRISPFSCLKDRNDFG
FPQEELDGNKFQKAQAISVHHEMIQQTFNLFSLQASSAAWDKTLLDKLYTGLYQQLNDLE
VCLMQEMGVEEAPVPVINEDSMLAVRKYFQRITVYLTEKKYSPCAWETVRAEVMSSFSAS
TNWKERLRSKEGDLAP
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccttctctttccttttgctcatcgccctggtggtgctcagctgcaactccacctgc
tctctgggctgtgacctgcctcagagccatagcctggctaacaggagaaccatgatgctt
ctgggacaaatgaggagaatctcccctttctcctgcctgaaggacagaaatgactttggg
tttccccaggaggagcttgatggcaacaagttccagaaggctcaagccatctctgtccac
catgagatgatccagcagaccttcaacctcttcagcctacaggcctcatctgctgcctgg
gataagaccctcctggacaaattgtacactggactctatcagcagctgaatgacctggaa
gtctgtttgatgcaggaaatgggggtagaagaagctcccgttcctgtgataaatgaggac
tccatgctggctgtgaggaagtacttccaaagaatcactgtctatctgacagagaagaaa
tacagcccttgtgcctgggagactgtcagagcagaagtcatgagctccttctctgcatct
acaaactggaaagaaaggctaagaagtaaggaaggcgacctggccccataa

DBGET integrated database retrieval system