KEGG   Loxodonta africana (African savanna elephant): 100659991
Entry
100659991         CDS       T04351                                 

Gene name
CDC25A
Definition
(RefSeq) M-phase inducer phosphatase 1 isoform X1
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04218  Cellular senescence
lav04914  Progesterone-mediated oocyte maturation
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100659991 (CDC25A)
   04218 Cellular senescence
    100659991 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100659991 (CDC25A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100659991 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100659991 (CDC25A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100659991 (CDC25A)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100659991 (CDC25A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100659991 (CDC25A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100659991 (CDC25A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100659991 (CDC25A)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100659991 (CDC25A)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 100659991
NCBI-ProteinID: XP_003409730
LinkDB
Position
Unknown
AA seq 524 aa
MELGPEPPHRRRLLFACSPPPAPPAVVKALFGAPAAGGLSPVTNLTVTMDQLXSLGCSEY
EQALEVKNSSLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRINSLPQKLLGCSPALK
RSHSDSLDHDVFHMIDQDENKENEAFEFKKPIRPASRGCLHSHGLEESKDLFTQRQNSAP
ARMLSSNERESSEPGNFLPLFLPQSPVTVTLSDEDDGFVDILDGESLKNDEETSSCMASL
WTAPLVMKRTTNLGNRCKLFDSSSMCSSTRSVLKRPERSQEESLFGNTKRRKSMTGASVE
EAATPEKPQEILHQSLSLASSPKGTIENILDSDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQSH
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggaactgggcccggagcccccgcaccgccggcgcctgctcttcgcctgcagcccccct
cccgcgccaccggccgtcgtaaaggcgctgttcggcgcgccagccgccggggggctgtcg
cctgtcaccaacctgacggtcaccatggaccagctnntttctcttggttgtagtgagtat
gagcaggcactggaggtgaagaacagcagtctgcagaggatgggctcctccgagtcaact
gattcaggcttctgtctggattctcctgggcccttggacagtaaagaaaaccttgaaaat
cccatgaggagaataaattccctacctcagaagctcctggggtgtagcccagctctgaag
aggagccattctgattctcttgaccatgatgtctttcacatgattgaccaggatgagaac
aaggaaaatgaagcctttgagtttaagaagccaatcagacctgcatctcgtggctgcctg
cactctcatggacttgaggagagtaaagatctcttcacgcagaggcagaactctgcccca
gctcggatgctttcctcgaatgaaagagagagcagcgagccagggaatttccttcctctt
tttctgccccagtcacctgtgacagtgactctgtctgatgaggatgatggcttcgtggac
attctcgatggagagagtcttaagaatgatgaggagacctcatcatgcatggcaagcctc
tggacagctccccttgtcatgaaaagaactacaaaccttggcaatcgatgcaagctgttt
gactcctcttccatgtgtagctctacccggtcagtgttgaagagaccagaacgatctcaa
gaggaatctctgtttgggaatacaaagcggaggaaaagcatgactggggccagtgtggaa
gaggcagccactccagagaagccccaggagattctacatcagtctttatccttggcatct
tccccaaaagggactattgagaacattttggacagtgacccaagggaccttataggagac
ttctctaagggatatctctttcatacagttgctgggaagcatcaggatttaaaatacatc
tctccagaaattatggcatctgttttgaatggcaagtttgccaaccttattaaagagttt
gttatcattgactgccgatacccatatgaatatgagggaggccacataaagggtgcggtg
aacttgcacatggaagaagaggttgaagacttcctactcaagaagcccattgtacctact
gatggcaagcgtgtcatcgtggtcttccactgtgaattttcttctgagcgaggcccccgc
atgtgccggtacgtgagagagagggatcggttaggtaatgagtaccccaaactccactac
cctgagctgtatgtcctaaaaggcggatacaaggagttcttcctgaagtgccagtctcac
tgtgaaccccccagctaccggcccatgcaccacgaggactttaaagaagacctgaagaag
ttccgcaccaagagccggacctgggcaggggaaaagagcaaaagggagatgtacagccgt
ctgaagaagctctga

KEGG   Loxodonta africana (African savanna elephant): 100664658
Entry
100664658         CDS       T04351                                 

Gene name
CDC25B
Definition
(RefSeq) M-phase inducer phosphatase 2
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04110  Cell cycle
lav04914  Progesterone-mediated oocyte maturation
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664658 (CDC25B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100664658 (CDC25B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100664658 (CDC25B)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100664658 (CDC25B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100664658 (CDC25B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100664658 (CDC25B)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100664658 (CDC25B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100664658 (CDC25B)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100664658 (CDC25B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100664658 (CDC25B)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100664658 (CDC25B)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 100664658
NCBI-ProteinID: XP_010589853
LinkDB
Position
Unknown
AA seq 523 aa
MHDLAGLGSETPKNQVGTLLFHSGSRLPCPSLSRRRASESSLSSESSEASDAGLCMDSPS
PMDPQVAEQTFEQAIQAASRVIRNEQFSIRRIQSMPVRLLGHSPVLRNITNTQAPDSWRR
SKAGSRAASSSVEDKENDGFVFKMPWKLAFPSHTQAMAEWASRREAFAQRPNSAPDLMCI
SPERKMEVGELNPLPRRRSSLTPMEGAAEEDDGFVDILESDLKDDDEVPPGMESLISAPL
VKTSEKEGEQDLIMYSKCQRLFRSPSMPCRAIRPVLKRLERPQDKDMPIQNKRRRSVTLP
EEQQEPEEPKARVLRSKSLCHDEIKNILDSDHRELIGDYSKAFSLQTVDGKHQDLKYISP
ETMVALLTGKFSNIVERFVIVDCRYPYEYEGGHIKTAVNLPLERDAENFLLQSPITACSL
DKRVILIFHCEFSSERGPRMCRFIRERDRAANDYPSLYYPEMYILKGGYKEFFPQHPTFC
EPQDYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgcacgacctcgccgggcttggcagcgagaccccaaagaatcaggtagggaccctgctc
ttccacagcggcagccggctgccgtgcccatccctgtcccgacgacgggcatctgagtcc
tccctgtcatctgagtcttctgaagcttctgatgcaggtctctgcatggactcccccagc
cccatggacccccaggtggcagaacagacgtttgaacaggccatccaggcggctagccga
gtcattcggaatgagcagttctccatcagacgtatccagtccatgccggtgaggcttctg
ggccacagccctgtgctccggaacatcaccaacacccaagcgccggacagttggaggcgg
agcaaggcaggcagcagagctgccagtagctccgtggaagacaaggagaacgatggattt
gtcttcaagatgccatggaagctggcatttcccagccacacccaggctatggccgagtgg
gccagccgcagagaagcctttgcccagaggccaaactcagcccccgacctgatgtgcatc
agccctgagcggaagatggaagtgggagagctgaaccccctgccccgacgccgctcctcc
ctgacccccatggagggggctgctgaggaagatgatggatttgtggacatcctggagagt
gacctaaaggatgatgatgaggtccccccaggcatggagagcctcatcagcgccccactg
gtcaagacctcagaaaaggaaggggagcaggacctcatcatgtacagcaagtgccagcgg
ctcttccgctctccgtccatgccctgcagggccatccggcccgtcctcaagaggctggag
cggccccaagacaaggacatgcccatacagaacaagcggaggaggagcgtaaccctgcct
gaggagcagcaggagcccgaagaacctaaggcccgagtcctccgctccaagtccctgtgt
catgatgagatcaagaacatcttggacagtgaccaccgtgagctgatcggggactactcc
aaggctttctctttacagactgtggatgggaaacaccaagacctcaagtacatctcacca
gaaacgatggtggccctgctgacgggcaagtttagcaacattgtggagaggtttgtgatt
gtggactgcagatacccctatgagtatgaaggcggccatattaagacagctgtaaacctc
cccctggaacgggacgctgagaacttcctgctgcagagccccatcacagcctgtagcctg
gacaagagagtcatcctcatcttccactgtgaattctcctctgagcgcgggccccgcatg
tgccgattcatccgggaacgagaccgtgctgctaacgactatcccagtctctactatcct
gagatgtatatcctcaaaggcggctacaaggagttcttcccacagcacccgactttctgt
gagccccaggactaccggcccatgaaccatgaggccttcaaggatgagctgaagaccttc
cgccttaagacacgcagctgggctggggagcggagccggcgggagctctgtagccggttg
caggaccagtga

KEGG   Loxodonta africana (African savanna elephant): 100670954
Entry
100670954         CDS       T04351                                 

Gene name
CDC25C
Definition
(RefSeq) M-phase inducer phosphatase 3
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
lav05170  Human immunodeficiency virus 1 infection
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100670954 (CDC25C)
   04114 Oocyte meiosis
    100670954 (CDC25C)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100670954 (CDC25C)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100670954 (CDC25C)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100670954 (CDC25C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100670954 (CDC25C)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100670954 (CDC25C)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100670954 (CDC25C)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100670954 (CDC25C)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100670954 (CDC25C)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100670954 (CDC25C)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100670954 (CDC25C)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100670954 (CDC25C)
SSDB
Motif
Pfam: Rhodanese M-inducer_phosp
Other DBs
NCBI-GeneID: 100670954
NCBI-ProteinID: XP_010589244
LinkDB
Position
Unknown
AA seq 497 aa
MSANPFSSTREEGGAGSGPSFRSNQRKRLNLLLERETSFTKCPGLPRTPVDKLLVDSGNL
SILSGGTPKRCLDLSNLSSGEMSAMSATQLTTSSDFDKTGHLDSSGPQEIQLARVNHHQH
LIEGSPAQLLCSTPNSLDHGHRKKNAICSSSTNKENENNTLKPVEWLSPRNLRFQKRPGG
PYLSPLSLLDNRNLLESEMKDLGSPITTVLKLDKNPELGEDQAEDISEDLMEFSLDQEDA
KASLNRSYLYRSPSMPENLNRPRLKQVVEFKDNPIVDQGLGLKKTVSLCDISITQILEED
SNKGHLIGDFSKVCALPTVSGRHQDLRYINPETVAALLWGKFQGLIEKFYIIDCRYPYEY
LGGHIQGALNLYSQEELHNFFLKKPIVPLDIQKRIIIVFHCEFSSERGPRMCRFLREEDR
ALNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKAELLKCRSQSKAWEG
ERQLREQIALLVKDVNP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtctgcaaatcccttctcatccacaagagaggagggaggcgctggttcaggacccagt
tttagatccaatcaaaggaagaggttaaacctgctgctggagagagagacttcctttacc
aagtgtccaggtctccctagaactccggtggacaaactcctggttgattctggaaaccta
agcattttgtctggaggaaccccaaaacgttgccttgatctttcgaatcttagcagtggg
gagatgtctgccatgtctgccactcagcttaccacctcttcagactttgataaaaccggt
catttggattcttcaggacctcaggaaatacagttagctagggtgaatcatcaccagcat
cttatagaaggcagcccagcgcaactgctgtgcagcactccaaattctttggaccatggc
cacagaaagaaaaatgcaatctgtagttcatctacaaataaagaaaacgaaaacaatact
ttgaagcccgtggagtggttgtcaccgaggaacctaagatttcaaaagagaccaggaggg
ccttatctttctcccctttctctgctggacaatcgaaacttgttggaaagtgaaatgaaa
gatctgggcagtcccattactacagttctaaaattggataaaaatccagaactgggagaa
gaccaggcagaggatatttcagaagacttgatggagttttccctggatcaagaagatgcc
aaggcatctctgaacagaagctacctgtatcgctccccttcaatgccagagaatttgaac
aggccaagactgaagcaggtggtagaattcaaggacaacccaatagtagatcagggctta
ggtttaaagaagacagtctctctctgtgacattagtattactcaaatactggaggaagat
tctaacaagggacatctgattggtgatttctccaaggtatgtgcactgccaactgtgtca
gggagacaccaagatctgaggtacatcaacccagaaacggtggctgccttactttggggg
aagttccagggtctgattgagaagttttacatcatcgattgccgctatccatatgagtac
ctgggaggacacatccagggagccttaaacttgtatagtcaggaggaattgcataacttc
tttctgaagaagcccattgtccctttggacatccagaaacggataattatcgtgtttcac
tgtgaattctcctcagagaggggtccccggatgtgccgctttctgagagaagaggacagg
gctttgaaccaatatcccgcgttgtactacccagaactgtacatcctcaaagggggctac
agagacttctttccagaatatatggagctgtgtgaaccgcagagctactgccctatgcac
caccaagaccataaggctgagctgctgaagtgtcgaagccagagcaaagcatgggaaggg
gaacggcagcttcgggagcagattgccctcctggtgaaggacgtgaacccatga

DBGET integrated database retrieval system