KEGG   Loxodonta africana (African savanna elephant): 100659992
Entry
100659992         CDS       T04351                                 

Gene name
CACNA1D
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04218  Cellular senescence
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659992 (CACNA1D)
   04020 Calcium signaling pathway
    100659992 (CACNA1D)
   04024 cAMP signaling pathway
    100659992 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    100659992 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100659992 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100659992 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100659992 (CACNA1D)
   04929 GnRH secretion
    100659992 (CACNA1D)
   04912 GnRH signaling pathway
    100659992 (CACNA1D)
   04921 Oxytocin signaling pathway
    100659992 (CACNA1D)
   04935 Growth hormone synthesis, secretion and action
    100659992 (CACNA1D)
   04924 Renin secretion
    100659992 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    100659992 (CACNA1D)
   04927 Cortisol synthesis and secretion
    100659992 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100659992 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    100659992 (CACNA1D)
   04270 Vascular smooth muscle contraction
    100659992 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100659992 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100659992 (CACNA1D)
   04727 GABAergic synapse
    100659992 (CACNA1D)
   04725 Cholinergic synapse
    100659992 (CACNA1D)
   04728 Dopaminergic synapse
    100659992 (CACNA1D)
   04726 Serotonergic synapse
    100659992 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    100659992 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100659992 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100659992 (CACNA1D)
   05020 Prion disease
    100659992 (CACNA1D)
   05022 Pathways of neurodegeneration - multiple diseases
    100659992 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100659992 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100659992 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100659992 (CACNA1D)
   05414 Dilated cardiomyopathy
    100659992 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100659992 (CACNA1D)
   04934 Cushing syndrome
    100659992 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659992 (CACNA1D)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100659992 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 100659992
NCBI-ProteinID: XP_023403870
LinkDB
Position
Unknown
AA seq 2168 aa
MMMMMMMKKMQHQRQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAAR
QAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACIS
IVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKII
AYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSGGKSGGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTC
FFADSDIVAEEDPAPCAFSGNGRQCTANDTECKSGWVGPNGGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSG
EGENQGCCASLWCWWKRRGAAKAGPSGCRRWSGLLSGFRSRRWRRWNRFSRRRCRAAVKS
VTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAY
FVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVAS
LLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQIL
TGEDWNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGWSFCIYFIILFIGGNYIL
LNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKV
TIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIIPIPEG
SAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFD
YAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKIL
RVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYR
CTDEAKSNPEECRGLFILYKDGEVDNPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGW
PALLYKAIDSNGENVGPIYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEY
KNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLA
MQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKHYFTDAWNTFDALIVVGSVVD
IAITEVNPTESENVPVPTAAPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTF
IKSFQALPYVALLIAMLFFIYAVIGMQMFGKVALRDNNQINRNNNFQTFPQAVLLLFRCA
TGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQHPXGFGKLCP
HRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEVVPPAGDDEVTVGKFYATFL
IQDYFRKFKKRKEQGLVGKHPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEEAN
REEEDLFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPA
GNSVCHNHHNHNSIGKQIPNSTNANLNNANMSKAAHGKRPSIANLEHVSDNGHHSSHKHD
REPQRRSSFKRTRYYETYVRSDSGDEQLPTICWEDSEIHGYFQDPRCLGEQEYFSSEEYY
EDDSSPTRSRHNNGYYNRYPGSSLDFERPRGYHHPQGFLEDDDSPVCYDRRSPRRRLLPP
TPTSHRRSSFNFECLRRQGSQEEVPPSPAFPHRTALPLHLMQQQIMAVAGLDSSKVQKYS
PSHSTRSWATPPATPPYQDWTPCYTPLIQVERSESLDQVNGSLPSLHRSSWYTDEPGIAY
RTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACD
LTIDEMESAASHLLNGNVSPRANGDVGPVSHQQDYELQDFGSGYSDEEPDPGRYEEDLAD
EMICITTL
NT seq 6507 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcaagcggaccacgcg
aatgaggcaaactatgcaagaggcaccagactccctctttctggtgaaggaccaacttct
cagccgaatagctccaagcagactgtcctgtcttggcaagctgcaatcgatgctgctaga
caggccaaggctgcccaaactatgagcacctccgcgcctccacctgtaggatctctctcc
caaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtccaacagccga
cctgcccgtgcccttttctgtttatcactcaataaccccatccgaagagcctgcattagt
atagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgtgtg
gccttagctatttacatcccattccctgaagatgattctaattcaaccaaccataacttg
gaaaaagtagaatatgccttcctgattatttttacagtcgagacatttttgaagattata
gcttatggattattgctacatcctaatgcttatgttaggaatggatggaatttattggat
tttgttatagtaatagtaggattgtttagtgtaattttggaacaattaaccaaagaaaca
gaaggcggtaaccactctggtggcaaatcaggaggctttgatgtcaaagccctccgcgcc
tttcgagtgttacgaccacttcgactagtatcaggagtgcccagtttacaagttgtcctg
aactccattataaaagccatggttcccctccttcacatagcccttttggtattatttgta
atcataatctatgctattataggattggaactttttattggaaaaatgcacaaaacatgc
ttttttgctgactcagatatcgtagctgaagaggacccagcgccatgtgcgttctcaggg
aatggacgccagtgtaccgccaatgacacagagtgtaagagtggctgggttggcccaaat
ggaggcatcacaaactttgataactttgcctttgccatgctcaccgtgtttcagtgtatc
accatggagggctggacagacgtgctctactggatgaatgatgctatgggatttgaattg
ccctgggtgtattttgtcagtctcgtcatctttgggtcatttttcgtactaaatcttgta
cttggtgtattgagcggagaattttcaaaggaaagagagaaggctaaagcacggggagat
ttccagaagctccgggagaagcagcagctagaagaggatcttaagggctacttggattgg
attacccaagcagaagacatcgatcctgagaatgaggaagaaggaggagaggaaggcaaa
cgaaatactagcatgcccaccagtgagaccgagtctgtgaacacggagaacgtaagcggc
gaaggcgagaaccaaggctgctgtgcaagtctctggtgctggtggaagagaagaggcgcg
gccaaggctgggccttcagggtgtcggcgctggagtgggctgctctcaggcttcagatcc
cgacgctggcgtcgctggaatcgattcagtcgaagaagatgtagggctgccgtgaagtct
gtcacgttttactggctggttattgtcctggtgtttctcaacaccttaaccatttcctct
gagcactacaaccagcctgactggttgacacagattcaagatatcgctaacaaagtcctc
ttggctctgttcacctgtgagatgttggtaaaaatgtacagcttgggactccaggcgtat
ttcgtctctcttttcaatcggtttgattgcttcgtggtgtgtggtggaattaccgaaact
attttagtggaactggaaatcatgtctcccctgggaatctccgtgtttcggtgtgtgcgc
cttttaagaattttcaaagtgaccaggcactggacttccctcagcaacctcgtggcgtcc
ttgttaaactccatgaagtccatcgcttcactgctgcttctgctctttctcttcatcatc
atcttttccttacttgggatgcagctgtttggcggcaagtttaattttgatgaaacgcaa
accaagcggagtacttttgacaatttccctcaagcgcttttaacagtgttccagatcctg
acaggtgaagactggaatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntc
cagggatggtcgttctgcatctacttcatcatccttttcattggcggtaactatattctg
ttgaatgtcttcttggccatcgccgtggacaatttggctgacgctgaaagtttgaacact
gctcagaaagaggaagcagaagaaaaagagcggaaaaagattgccagaaaagagagcctg
gaaaataaaaagaacaacaaaccagaagtcaaccagatagccaacagtgacaacaaggtt
acaattgatgactaccgagaagaggatgaggacaaggacccctacccaccttgtgatgtg
ccagtaggggaagaggaagaggaggaggaagaggatgaacccgaggtccctgctggtccc
cgtcctcgcagaatctcagagttaaacatgaaggagaaaatcattcccatccctgaagga
agcgctttcttcattcttagcaagaccaacccgatccgcgtgggctgccacaagctcatc
aaccaccacatcttcactaaccttatcctggtcttcatcatgctgagcagcgctgccctc
gcggccgaggaccccatccgcagccactccttccggaacactatactgggttactttgac
tatgctttcacagccatctttactgttgaaatcctgttgaagatgacgacttttggagct
ttcctccacaaaggggctttctgcaggaactacttcaatttgctggatatgctggttgtt
ggggtgtctctggtgtcatttgggattcaatccagcgctatctccgttgtgaagattctg
agggtcctaagggtcctcaggcccctcagggcaatcaacagagcaaaaggacttaagcat
gttgtccagtgtgtctttgtggccatccggacaatcggcaacatcatgatcgtcaccacc
cttctccagttcatgtttgcctgtattggggtccagttgttcaagggaaagttctatcgc
tgcacagatgaagccaaaagtaaccctgaagaatgcagggggcttttcattctctacaag
gatggggaggtcgataaccctgtggtgcgtgagaggatctggcagaacagtgatttcaat
tttgacaacgtcctatctgctatgatggcacttttcacagtctccacatttgagggctgg
cctgcattgctgtataaagctattgactcaaacggtgagaacgtcggcccgatctacaac
taccgcgtggagatctccatcttcttcatcatctacatcatcattgtggctttcttcatg
atgaacatctttgtgggtttcgtcatcgttacgtttcaggagcagggagaaaaagagtat
aagaactgtgagctggacaaaaatcagcgtcagtgcgttgaatatgccttgaaagctcgt
cctttgcggagatacatcccgaaaaacccctaccagtacaagttctggtacgtggtgaac
tcctcgcctttcgaatacatgatgtttgtcctcatcatgctcaacacactctgcttggcc
atgcagcactatgagcagtctaagatgtttaatgacgccatggacatcctgaacatggtc
ttcactggggtgttcaccgttgagatggttttaaaagtcattgcatttaaacctaagcac
tatttcactgatgcatggaacacttttgatgccttaattgttgttggtagcgtcgttgat
attgctataactgaagtgaatccaactgaaagtgaaaatgtccctgtcccaactgctgca
cctgggaactctgaagagagcaatagaatctccatcacctttttccgtcttttccgagtg
atgcgactggtgaagcttctcagcaggggagaaggcatccggacattgctgtggactttt
attaaatcctttcaggccctcccatatgtcgcccttctcatagccatgcttttcttcatc
tatgctgtcatcggaatgcagatgtttgggaaagttgccctgagagataacaaccagatc
aataggaataataacttccaaacctttccccaggcggtactgctgctcttcaggtgtgcc
actggggaggcctggcaggaaatcatgctggcctgcctccctgggaagctgtgtgaccca
gagtcagattacaaccccggggaggagtacacgtgcgggagcaattttgccatcgtttat
ttcatcagtttttacatgctctgtgcatttctgatcatcaatctgtttgtggccgtcatc
atggacaactttgattatctgacccgggactggtctattttgggacctcaccatttagat
gaattcaaacgaatatggtcagaatatgaccctgaagcaaagggaaggataaaacacctg
gacgtggtcactctgcttcgacgtatccagcaccctnnggggtttgggaaattatgccca
cacagagtagcatgcaagagattagttgctatgaacatgcctctcaacagtgatgggaca
gtcatgttcaatgcaaccctgtttgccttggttcgaactgctcttaaaatcaagactgaa
gttgtccctccagctggtgatgatgaggtaaccgtggggaagttctatgccactttcctg
atacaggactactttaggaaattcaagaaacggaaagaacaaggactggtgggaaaacac
ccagcgaagaacaccacaattgccctacaggcgggattaaggacactacacgacattggg
ccagaaatccggcgggctatatcctgtgatttgcaagatgatgagccagaagaagcaaac
cgagaagaagaagatttgttcaaaagaaatggtgccctgcttggaaaccatgtcaatcat
gttaatagtgataggagagattcccttcagcagaccaataccacccaccgtcccctgcat
gtccaaaggccttcaattccacctgcaagtgatactgagaaaccgctgtttcctccagca
ggaaattcggtgtgtcataaccatcataaccataattccataggaaagcaaattcccaac
tcaacaaatgccaatctcaataatgccaatatgtccaaagctgcccatggcaagcggccc
agcattgcgaaccttgagcatgtgtctgacaatgggcatcattcctcccacaagcatgac
cgtgagcctcaaagaaggtccagttttaaaagaacccgctattatgaaacttacgttagg
tccgactctggagatgaacagctcccgactatttgctgggaagattcagagatacatggc
tacttccaggatccccgctgcttaggggagcaggagtatttcagcagtgaggaatactac
gaggatgacagctcgccgaccagaagcaggcataacaatggctactacaacagataccca
ggcagcagcttggacttcgaaaggccccgaggctaccaccacccccaaggcttcttagag
gacgatgactcacccgtttgctacgatcggagatctccaaggagacgcctactacctcca
accccaacatcccaccggagatcctccttcaactttgagtgcctgcggaggcagggcagc
caggaagaggtcccgccgtcgccggcttttccccaccgcacagcgctgcctctgcacctc
atgcagcaacagatcatggcagttgcaggcctagattcgagcaaagtccagaagtactca
ccgagtcactcgacccggtcatgggccacccccccagcgacgcccccctaccaggactgg
acgccctgctacacccccctgatccaggtagagcggtcagagtccctggaccaggtcaat
ggcagcctgccgtccctgcaccgcagttcctggtacacagatgaacctggtatcgcctat
cggactttcacgccagccagcctgactgtccccagcagcttccggaacaaaaacagcgac
aagcagaggagtgcggacagcttggtggaggcagtcctcatatctgaaggcttaggacgg
tatgcaagggacccgaaatttgtatcagcaacaaaacatgagattgccgatgcctgtgac
ctaaccattgacgagatggagagtgcagccagccacctgctcaacgggaacgtgagtccc
cgagccaatggggacgtgggccccgtctcacaccagcaggactatgagctacaagacttt
ggttctggctacagcgatgaagagccagaccctgggagatatgaggaggacctggcagat
gaaatgatatgcatcactaccttgtag

DBGET integrated database retrieval system