KEGG   Loxodonta africana (African savanna elephant): 100659997
Entry
100659997         CDS       T04351                                 

Gene name
BST1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00760  Nicotinate and nicotinamide metabolism
lav01100  Metabolic pathways
lav04970  Salivary secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100659997 (BST1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100659997 (BST1)
   04972 Pancreatic secretion
    100659997 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100659997 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
    100659997 (BST1)
Enzymes [BR:lav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     100659997 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     100659997 (BST1)
CD molecules [BR:lav04090]
 Proteins
  100659997 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Enzymes
  100659997 (BST1)
SSDB
Motif
Pfam: Rib_hydrolayse AFG1_ATPase
Other DBs
NCBI-GeneID: 100659997
NCBI-ProteinID: XP_003411412
LinkDB
Position
Unknown
AA seq 290 aa
MAVRGCLQCLPLLLLAAGCVDARWSGEGTSPHLRTIFLGRCSDYSSLLSPQQRICQDQES
FHRFVLLEKHLHDTLSLFWENNHLLVTSYADNARRFMPLRDVLYGRVGDFLSWCRQKNAS
GLDYQSCPTSDDCENNPVDSYWKRASIQYSTDSSGVIYVMLNGSDPKGAYPVRGFFADYE
IPNFQKDKITRFEIWVMHEIGGPNVESCGEGSVKILEERLKEMGFQYSCINDHLPVKLLQ
CVDHSTHPDCAVHSKAAPAYMVGYSLLHSFARTGHYLFLYLHLYLAAAST
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcggtgcgggggtgcttgcagtgtctgccgctgctgctgctggctgcgggctgcgtg
gacgcgcggtggagcggggagggcaccagtccgcacctgcggaccatctttctgggccgc
tgcagcgactacagctcgctgctcagcccccaacagcgtatttgtcaagaccaggaatct
ttccacagatttgtgctactggaaaaacatttgcatgataccctttccctgttctgggaa
aataaccacctgctcgtgactagctatgcagataacgcccgtcgttttatgccgctgcgt
gatgttctgtacggcagggttggagatttcttgagctggtgtcgacagaaaaatgcttct
ggacttgactaccaatcctgccctacatcagatgattgtgaaaacaatcctgtggattct
tactggaaaagggcatctatccagtattccacggatagttctggggtgatctacgttatg
ctgaatggttctgatccaaagggagcctatcctgtcaggggcttttttgcagactatgaa
attccgaacttccagaaggataaaatcacacgatttgagatctgggtaatgcacgaaatc
ggaggaccaaatgtggaatcctgtggagaaggcagtgtgaaaatactggaagagagactg
aaggaaatgggttttcagtacagctgtattaatgatcaccttccagtgaagctcttacag
tgtgtggaccacagcactcatcccgactgtgccgtacattcaaaggctgcaccagcgtat
atggtggggtattccttactgcattccttcgccagaactggacattacctgttcctatat
cttcacctctacttggcagcagcttctacttaa

KEGG   Loxodonta africana (African savanna elephant): 100660287
Entry
100660287         CDS       T04351                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00760  Nicotinate and nicotinamide metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04640  Hematopoietic cell lineage
lav04921  Oxytocin signaling pathway
lav04970  Salivary secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100660287 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100660287 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100660287 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100660287 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    100660287 (CD38)
   04972 Pancreatic secretion
    100660287 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100660287 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100660287 (CD38)
Enzymes [BR:lav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     100660287 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     100660287 (CD38)
CD molecules [BR:lav04090]
 Proteins
  100660287 (CD38)
Glycosaminoglycan binding proteins [BR:lav00536]
 Hyaluronan
  Cell surface receptors
   100660287 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 100660287
NCBI-ProteinID: XP_023405561
LinkDB
Position
Unknown
AA seq 305 aa
MAGQLSWRTLGRCARILRQVPEPGGAAGVAHPRRAQPRGAKGKSAAGANVCPAFVSLQGV
SVCALCRESARVLQKRIPGGSADKALIQQLGVTNPRKDVAACFPEKNCKEIWKAFKNSFI
SKDPCSITEEDYLPLMKLTNQTVPCHQTLFWSKIPTLARQLFQDQRKVFSLEDLLLGSIT
GGLTWCGSRGTSEMNYQSCPDWRKDCSNNPVSVFWKTASKKFAADACGEVLALLNGSIPE
PFDRNSIFGSVEILNLNSKAVHLLQAWVIHDAGDSRDSCLSSSINDLKSIITERNIRFTC
QKEYR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggccggtcagctcagctggcggacccttggcagatgtgcccgcatcctgcgtcaggtg
ccggagcccggcggagccgcgggtgtagcccaccctcggcgcgcacagccccgtggcgcg
aagggaaaatcagcagcaggcgcgaatgtttgccctgcgtttgtctctttgcaaggggtt
tccgtttgcgcgctttgccgggaaagtgcccgagtgttacagaagagaatccctggtggc
tcagcagataaagcgctaatccagcagttgggagtcaccaaccccaggaaagatgtggcg
gcctgctttccagagaagaattgcaaggagatatggaaggcattcaaaaattcatttatt
tccaaggacccttgcagcattacagaagaagactacctaccattaatgaagttgacaaat
caaactgtaccttgccaccagacactcttttggagcaaaatacctactctggcccgtcag
ctcttccaggaccagcgaaaggtgttcagcctggaggacttactgctgggcagcataact
ggtggcctcacttggtgtggaagccggggcacgtctgaaatgaactatcaatcttgccca
gactggaggaaagactgcagcaacaaccccgtttctgtattctggaagacagcttccaaa
aagtttgcagcagatgcctgtggtgaggtcctcgcgctgctcaatgggtccatccctgaa
ccctttgaccgaaacagtatatttggaagtgtggagattcttaatttgaattcgaaggca
gttcatttactacaggcctgggtgatacatgacgctggagactccagggactcgtgcttg
agttcttccataaacgaccttaagtcaatcattaccgaaagaaatattagatttacctgc
cagaaggagtacaggtaa

DBGET integrated database retrieval system