KEGG   Loxodonta africana (African savanna elephant): 100660003
Entry
100660003         CDS       T04351                                 

Gene name
ABCC8
Definition
(RefSeq) ATP-binding cassette sub-family C member 8 isoform X2
  KO
K05032  ATP-binding cassette subfamily C (CFTR/MRP) member 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav02010  ABC transporters
lav04911  Insulin secretion
lav04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100660003 (ABCC8)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100660003 (ABCC8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100660003 (ABCC8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100660003 (ABCC8)
Transporters [BR:lav02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC8, 9 subgroups
    100660003 (ABCC8)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 AAA_25 RsgA_GTPase ATPase Zeta_toxin cobW
Other DBs
NCBI-GeneID: 100660003
NCBI-ProteinID: XP_010590506
LinkDB
Position
Unknown
AA seq 1634 aa
MQHIFIKKMRIKNCTSIQLPFSTQQLIYLMTCHMRAAYKNEVPAHVGLHGLVSCVPLGDP
HAHMYKCLHFPRLTVDLMHPPGTHQVSPRWARPACLSLSLPAGWGSQSSKVHIHHSTWLH
FPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAVTSVVYYHNI
ETSNFPKLLIALLVYWTLAFITKTIKFVKFYDHAIGFSQLRFCLTGLLVILYGMLFLVEV
NVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTAHKKPIDL
RAIGKLPITMRALTNYQRLCEAFDTQARKDTQSTQGARAIWRALCHAFGRRLILSSTFRI
LADLLGFAGPLCIFGIVDHLGKENRVFQPKTQFLGVYFVSSQEFLANAYVLAVLLFLALL
LQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNLVAIDTNQ
LMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATKLSQAQRS
TLEYSNDRLKQTNEMLRGIKLLKLYAWENIFRTRVEVTRRKEMTSLRAFAIYTSISIFMN
TAIPIAAVLITFVGHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSV
QKLSEFLSSAEILEEQCAPREPAPQGQASKYQAVPLKVVNRKRPVWEDRRGLTGPLQRLA
PSADGDADNCCVQIIGGFFTWTPNGIPTLSNITIRIPRGQLTMIVGQVGCGKSSLLLATL
GEMQKISGAVFWNSLPDSETGEEASPERETSADSDVRKRGPVAYASQKPWLLNATVEENI
TFESPFNKQRYKTVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQHT
NVVFLDDPFSALDVHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWIIAMKDGTI
QREGTLKDFQRSECQLFEDWKTLMNRQDQELEKETVMERKATEPSQGLPRALSSRDGLLQ
DEEEEEEEVAESEEEDNLSSVLHQRAKIPWRACAKYLSSAGILLLSLLVFSQLLKHMVLV
AIDYWLAKWTDSALTLSPMARNCSLSQGCSLDQTVYAMVFTVLSSLGIVLCLVTSVTVEW
TGLKVAKRLHRSLLNQIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPSTLECLSRSTL
LCVSALAVISYVTPMFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPLLSHFAETV
EGLTTIRAFRYEARFQKKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAVTSI
SNSLHGELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHGLLKTEAESYEG
LLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALISPGQKIGICGRTGSGKSSF
SLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLDPEKKCSD
STLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEA
TASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFDKPEKLLS
RKDSVFASFVRADK
NT seq 4905 nt   +upstreamnt  +downstreamnt
atgcaacatatattcataaaaaaaatgcgtatcaaaaattgtactagcattcaacttccg
ttctcaacccaacagcttatctacctgatgacttgtcacatgagagccgcatataaaaat
gaggtgcctgcccatgtgggcctgcatggcctggtttcatgtgtaccactgggggatcct
catgcacacatgtacaaatgtctacacttcccacgcctcactgtggatctcatgcaccct
cctgggacccaccaggtctcccctaggtgggccaggcctgcctgcctctcactgtctctc
cctgcaggatggggcagtcagagctccaaggtgcacattcaccacagcacgtggctccac
tttccgggacacaacctgcgctggatcctgaccttcatgctgctgtttgtcctggtgtgt
gagatcgcggagggcatcctgtctgacggggtgactgaatcccgccatctccacctgtac
atgccagctgggatggcgttcatggccgccgtcacctctgtggtctactatcacaacatc
gagacctccaacttccccaagctgctcatcgccctactagtctactggaccctggccttc
ataaccaagaccatcaagtttgtcaagttctacgaccacgccattggcttctctcagctg
cgcttctgcctcacagggctgctggtgatcctctacggaatgctgttccttgtggaggtc
aatgtcatcagggtgaggagatatatcttcttcaagacaccaagggaggtgaagccccct
gaggacctgcaggacctgggagtgcgcttcctgcagcccttcgtaaacctgctgtccaag
ggcacctactggtggatgaatgccttcatcaagactgcccacaagaagcccattgacctc
cgagccatcgggaagctgcccatcaccatgagggccctcaccaactaccagcggctctgc
gaggcctttgacacccaggcgcggaaggacacgcagagcacacagggtgcccgggccatc
tggcgggcactctgccatgccttcgggagacgcctgatcctcagcagcactttccgcatc
ttggccgacttgctgggtttcgccgggccactgtgcatatttgggatcgtggaccacctt
gggaaggagaatcgggtcttccagcccaagacacaatttctcggggtttactttgtctca
tcccaagagttccttgctaatgcctacgtcttagctgtgcttttgttcctcgctctcctg
ctgcaaaggacatttctgcaagcttcctactatgtcgccattgaaactggaattaacttg
agaggagcaatacagaccaagatttacaataaaattatgcacctgtccacctccaacttg
tccatgggggaaatgactgctgggcagatctgtaacctggttgccatcgacaccaaccag
ctcatgtggtttttcttcttgtgcccaaacctctgggctatgccagtacagataattgtg
ggtgtaattctcctctactacatcctcggagtcagtgccttaattggagcagctgtcatc
attctcctggcccctgtccagtattttgtggccaccaagctctcccaggcccagaggagc
acgctggagtattccaacgacaggctgaagcagaccaatgagatgctccgtggcatcaag
cttctgaagctgtacgcctgggagaacatcttccgcacacgggtggaggtgacacgcagg
aaggagatgaccagcctcagggcctttgccatctacacctccatctccattttcatgaac
acggccatccccattgcagccgtcctcatcacctttgtgggccatgtcagcttcttcaag
gaggccgacttctctccctcggtagccttcgcctccctctctctcttccacatcctggtc
acaccgctgttcctgctgtccagtgtggtccgatccacggtcaaagctctagtcagtgtg
caaaagctgagtgagtttctgtccagtgcagagatccttgaggagcagtgtgctccccgt
gagcctgcaccccaaggccaagccagcaagtatcaggcggtgcccctcaaggttgtgaac
cgcaagcgtccagtatgggaggatcgccggggcctcacggggccgctgcagaggctggcc
cccagcgcagatggggatgccgacaactgctgtgttcagatcatcggaggcttcttcacg
tggacccccaatgggattcccacactgtccaacatcaccattcgtatcccccgaggtcag
ctaaccatgattgtggggcaggtgggctgcggtaagtcctccctcctcctagccacgctg
ggggagatgcagaagatctcaggggccgtcttctggaacagccttcctgacagcgagacg
ggagaggaggccagcccggagcgggagacatcagctgactcggatgtcaggaagagaggc
cccgtggcctatgcttctcagaaaccatggctgctaaatgccactgtggaggagaacatc
acctttgagagtccctttaacaagcaacggtacaagacggtcattgaggcctgctccctg
cagccagacatcgacatcctgcctcatggagaccagactcagataggagagcggggcatc
aacctgtctgggggtcagcgccaacgaatcagtgtggcccgagccctctaccagcacacc
aatgtcgtcttcttggatgaccccttctcagctctggatgtccatctgagtgaccatctg
atgcaggctgggattcttgagcttctccgggatgacaagaggacagtggtcctagtgacc
cacaaactacagtacctaccccatgcagattggatcattgctatgaaggacggcaccatc
cagagggagggcacactcaaggacttccagaggtctgagtgccagctctttgaggactgg
aagaccctcatgaaccgccaggaccaagaactggagaaggaaaccgtcatggaaagaaag
gccacagagccatcccaaggcctgccccgggccctgtcctcgagagatggccttttgcag
gatgaggaagaggaggaagaggaggtggctgagagcgaggaggaagacaacctgtcgtcg
gtgctgcaccagcgcgccaagatcccgtggcgagcctgtgccaagtacctgtcttccgct
ggcatcctgctcctgtcgctgcttgtcttctcccagctgctcaagcacatggtcctggtg
gctatagactactggctggccaagtggactgacagtgcactgaccctgagccccatggcc
aggaactgctcccttagccaggggtgctccctcgaccagacggtctatgccatggtgttc
acggtgctctccagcctgggcattgtgctgtgcctcgtcacatctgtcaccgtggagtgg
acgggactaaaggtggccaagaggctgcaccgaagcctgctgaaccagatcatcctggcc
cccatgaggttttttgagaccacacccctgggaagcatcctgaacagattttcgtctgat
tgtaacaccattgaccagcacatcccatccacactggagtgcctgagccgttccaccctg
ctctgtgtctcagccttggccgtcatctcctatgtcacacccatgttccttgtggccctc
ttgcctctggccgttgtgtgctacttcatccagaagtacttccgggtggcatccagggac
ctgcagcagctggatgacaccacccagctcccattgctttcgcacttcgctgaaactgtg
gaaggcctcaccaccatccgggccttcaggtatgaggcccggttccagaagaagctcctc
gaatacacagactccaacaatatcgcctccctcttcctcacagcagccaacagatggctg
gaagttcgcatggagtacattggtgcatgcgtggtcctcattgcagccgtgacctccatc
tccaactccctgcacggggagctctcggccggcctggtgggccttggcctcacctatgcc
ctcatggtctccaactacctgaattggatggtgaggaacctagcagacatggagatccag
ctgggggctgtgaaacgtatccacgggctcctgaaaactgaggcagagagctacgagggg
ctgctggcaccatcactgatcccgaagaactggccagaccaagggaagatccagatccag
aacctgagcgtgcggtacgacagctccctgaagcctgtgctgaagcacgtcaatgccctc
atctccccaggacagaagattgggatctgcggccgcacaggcagtgggaagtcttccttc
tctctcgccttcttccgcatggtggacatgttcgaagggcgaatcatcattgatggcatc
gacattgcaaaactgccactgcacaccctgcgctctcgcctctccatcatccttcaggac
cctgtcctcttcagcggcaccatccgatttaacctggacccagagaagaaatgctctgac
agcacgctgtgggaggccctggagatcgcccagttgaagctggtggtaaaagcactgcca
ggaggccttgatgccatcatcacagaaggtggggagaatttcagccagggccagaggcaa
ctgttctgcctggctcgggccttcgtgaggaagacaagcatcttcatcatggatgaggct
acagcatccatcgacatggccacggaaaacatcctccagaaggtggtgatgacagccttc
gcagatcgcactgtggtcaccattgcgcaccgcgtgcacaccatcctgagtgcagacctg
gtgatcgtcctgaagcgtggcgccatccttgagtttgacaagccagagaagttactcagc
cggaaggacagtgtcttcgcctcctttgtccgcgcagacaagtga

DBGET integrated database retrieval system