KEGG   Loxodonta africana (African savanna elephant): 100660030
Entry
100660030         CDS       T04351                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav03320  PPAR signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04510  Focal adhesion
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04931  Insulin resistance
lav04960  Aldosterone-regulated sodium reabsorption
lav05145  Toxoplasmosis
lav05205  Proteoglycans in cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05223  Non-small cell lung cancer
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100660030 (PDPK1)
   04071 Sphingolipid signaling pathway
    100660030 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100660030 (PDPK1)
   04152 AMPK signaling pathway
    100660030 (PDPK1)
   04150 mTOR signaling pathway
    100660030 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100660030 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100660030 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100660030 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100660030 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100660030 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660030 (PDPK1)
   03320 PPAR signaling pathway
    100660030 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100660030 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100660030 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100660030 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100660030 (PDPK1)
   05231 Choline metabolism in cancer
    100660030 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100660030 (PDPK1)
   05213 Endometrial cancer
    100660030 (PDPK1)
   05223 Non-small cell lung cancer
    100660030 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100660030 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100660030 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100660030 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100660030 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660030 (PDPK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100660030 (PDPK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100660030 (PDPK1)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100660030 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100660030
NCBI-ProteinID: XP_010595691
UniProt: G3SPQ1
LinkDB
Position
Unknown
AA seq 558 aa
MARTTSQLYDAVPIQPSVVLCSCSSPSMVRSQTDAGSAPAVPSSSSRQGPSMDGTMVEPR
PGANALQHAAQPPAQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKAACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMDGYTPLKAHSFFESIIWENLHHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSCHSLSAPEPGLPQRSGSNIEQYIHD
LDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPINKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRQRYQNQPDAAVQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggcccggaccaccagccagctctatgacgccgtccccatccagcccagcgtggtgtta
tgttcctgctcatccccatccatggtgaggagccagactgatgccggcagcgcccctgct
gttcccagcagcagcagcaggcaggggcccagcatggatggcaccatggttgagcccagg
cctggcgccaatgccctgcagcacgctgctcagccgccggcccagcctcgcaagaagcgg
cccgaagacttcaagtttggaaagattcttggcgaaggctctttttccacagtcgtcctg
gcccgagaactggccacctcaagagaatatgcgattaaaattcttgagaaacgtcacatc
atcaaggagaacaaggtcccgtatgtgaccagagaacgggatgtgatgtcgcgcctggac
caccccttcttcgtgaagctttacttcacattccaggatgacgagaagctgtattttggc
cttagttatgccaaaaatggagaactacttaaatacattcgcaaaattggctcattcgat
gagacctgtacccgattttataccgccgaaatcgtgtctgctttagagtacctgcatggc
aaaggcatcatccacagggaccttaaaccagagaacattctgttgaatgaagacatgcat
atccaaatcacagactttggaaccgccaaagtgctctcccctgagagcaagcaagccagg
gccaactcatttgtgggaacagcccaatacgtctctccagagctgctcacagagaaggcg
gcctgtaaaagttcagacctttgggcccttggctgcataatctaccagcttgtggcagga
ctcccaccgttcagagcaggaaatgagtatcttatcttccagaagatcattaagttggaa
tatgactttccagaaaaattcttccccaaggccagagaccttgtggaaaagcttttggtc
ttagatgccacgaagcgattaggctgtgaggagatggacggttacacgcctctgaaagcc
cactcgttcttcgagtctatcatatgggagaacctgcaccaccagacacccccaaagctc
acggcctacctgccagcgatgtccgaggacgatgaggactgctacgggaactatgacaac
ctcctgagccagttcggctgcatgcaggtatcctcatcatcctcgtgccactccctatca
gccccagagccaggcctcccacagcgctctggcagcaacatcgagcagtacatccacgac
ctggattcgaactcttttgaactggacttacagttctctgaggatgagaagaggttactg
ttggagaagcaggctggtgggaacccttggcaccagtttgtagaaaataacttaatacta
aaaatgggtccagtagataagcggaagggtttatttgctcgccgacgacagctactgctc
acagaagggccacatctatactacgtggatcccatcaacaaagtcctgaaaggggagatc
ccatggtcacaggagctccgaccagaggcgaagaactttaaaaccttctttgttcacaca
cctaaccggacgtactacctgatggacccaagcggcaatgctcacaagtggtgcaagaag
atccaggaggtgtggaggcagaggtaccagaaccagccggacgctgctgtgcagtga

DBGET integrated database retrieval system