KEGG   Loxodonta africana (African savanna elephant): 100660067
Entry
100660067         CDS       T04351                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04630  JAK-STAT signaling pathway
lav04910  Insulin signaling pathway
lav04917  Prolactin signaling pathway
lav04930  Type II diabetes mellitus
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100660067 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660067 (SOCS2)
   04917 Prolactin signaling pathway
    100660067 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    100660067 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100660067 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100660067 (SOCS2)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100660067 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 100660067
NCBI-ProteinID: XP_003405308
UniProt: G3UJT6
LinkDB
Position
Unknown
AA seq 198 aa
MTLRCLEPSGNGAEGTRSQWGIAASAEEPSPEAARLATALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKGTSPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLIINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcggagccagtgg
ggtatcgcggcctcggcggaggagccgtctccggaggcagcgcgtctggcgacggccctg
cgggagctcagtcaaactggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagttcgcattcagactac
ctactgacaatatctgttaaaacatcagctggaccaactaatctgcgaattgaataccaa
gatgggaaattcagattggactcaatcatatgcgtcaagtccaagcttaaacagtttgac
agtgtggttcacctgatcgactactatgttcagatgtgcaaggataaggggacgagccca
gaagccccccggaatggcaccgtacacctttatctgaccaaaccactctacacgtcagca
ccgtctctgcagcatctgtgtagactcatcattaacaaatgtactggtaccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Loxodonta africana (African savanna elephant): 100664110
Entry
100664110         CDS       T04351                                 

Gene name
SOCS1
Definition
(RefSeq) LOW QUALITY PROTEIN: suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04120  Ubiquitin mediated proteolysis
lav04380  Osteoclast differentiation
lav04630  JAK-STAT signaling pathway
lav04910  Insulin signaling pathway
lav04917  Prolactin signaling pathway
lav04930  Type II diabetes mellitus
lav04935  Growth hormone synthesis, secretion and action
lav05145  Toxoplasmosis
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100664110 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100664110 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100664110 (SOCS1)
   04917 Prolactin signaling pathway
    100664110 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    100664110 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100664110 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100664110 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100664110 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100664110 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100664110 (SOCS1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100664110 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100664110
NCBI-ProteinID: XP_010595783
LinkDB
Position
Unknown
AA seq 245 aa
MGGPAGAEQSELRPWQLHGSSPRSMRESRPGAPPPPRPRRPAPRRQPPGRTQADLRVRGT
RSVVFLLPLPKSPERGAGPRPGQQAANRGPGGQSRAGFSRALSPRPLLRPKPLYWGPLSV
HGAHERLRSEPVGTFLVRDSRQXNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDC
LFELLEHYVAAPRRLLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSS
FPFQI
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggtggcccggcgggcgcggagcagagcgagctgcggccgtggcagctgcacggctcc
tcgccccggagcatgcgcgagagccgccccggagcccccccgccgccccgcccgcggcgc
ccagcgccccgccgccagcccccgggccgcacccaggccgacctccgcgtgcggggtacc
cgcagcgtggtctttctcctgcctttgcccaaatccccggaacgaggcgctggtccccgc
cctggccagcaggcggcgaaccgagggccgggcggccagagtcgggcaggcttctcccgg
gcactctctccacgcccccttctgcgacccaaacccctctactggggacccctgagcgtg
cacggggcgcacgagcggctgcgctcggaacccgtgggcacctttctggtgcgcgacagc
cgccaancgaactgcttcttcgccctcagcgtgaagatggcctcgggccccactagcatc
cgcgtgcacttccaggccggccgcttccacctggacggcagccgcgagagcttcgactgc
ctcttcgagctgctggagcactacgtggcggcgccgcgccgcttgttgggggccccgctg
cgccagcgccgcgtgcggccactgcaggagctgtgccgtcagcgtatcgtggccaccgtg
ggccgtgagaacctggcgcgcatccccctcaaccctgtcctccgggactacctgagctcc
ttccccttccagatctaa

KEGG   Loxodonta africana (African savanna elephant): 100670741
Entry
100670741         CDS       T04351                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04120  Ubiquitin mediated proteolysis
lav04380  Osteoclast differentiation
lav04630  JAK-STAT signaling pathway
lav04668  TNF signaling pathway
lav04910  Insulin signaling pathway
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04935  Growth hormone synthesis, secretion and action
lav05160  Hepatitis C
lav05164  Influenza A
lav05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100670741 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100670741 (SOCS3)
   04668 TNF signaling pathway
    100670741 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100670741 (SOCS3)
   04920 Adipocytokine signaling pathway
    100670741 (SOCS3)
   04917 Prolactin signaling pathway
    100670741 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    100670741 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100670741 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100670741 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    100670741 (SOCS3)
   04931 Insulin resistance
    100670741 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100670741 (SOCS3)
   05164 Influenza A
    100670741 (SOCS3)
   05168 Herpes simplex virus 1 infection
    100670741 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100670741 (SOCS3)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100670741 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box Exostosin
Other DBs
NCBI-GeneID: 100670741
NCBI-ProteinID: XP_010595219
UniProt: G3U788
LinkDB
Position
Unknown
AA seq 228 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPAGAPSASSPPPEPSSPSSEVPEQPPAQPPTGSTPRKAYYIYSGGEKIPLV
LSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 687 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctcgtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgccgtgacgggcggcgaggcgaacctgctgctg
agcgccgagcccgccggcaccttcctcatccgcgacagctcggaccagcgccacttcttc
actctcagcgtcaagacccagtcggggaccaagaacctgcgcatccagtgcgaggggggc
agcttctcactgcagagcgaccctcggagcacgcagcccgtgccccgcttcgactgtgtg
cttaagctggtgcatcactacatgccacccgcgggggccccctcagcctcctcgccccca
cctgagccctcctcgccctcctccgaggtgcccgagcagccacctgcccagccgcccacg
gggagcacccctaggaaagcctattacatctattcggggggcgagaagatccccctggtg
ttgagccgacccctctcctccaatgtggccaccctccagcatctctgtcggaagaccgtc
aacggccacctggactcctatgagaaggtcacccagcttcctgggccgatacgggagttc
ctggaccagtatgacgcccccctttaa

DBGET integrated database retrieval system