KEGG   Loxodonta africana (African savanna elephant): 100660153
Entry
100660153         CDS       T04351                                 

Gene name
BUB1
Definition
(RefSeq) mitotic checkpoint serine/threonine-protein kinase BUB1 isoform X1
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100660153 (BUB1)
   04114 Oocyte meiosis
    100660153 (BUB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100660153 (BUB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100660153 (BUB1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100660153 (BUB1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100660153 (BUB1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  BUB family
   100660153 (BUB1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     100660153 (BUB1)
SSDB
Motif
Pfam: Mad3_BUB1_I Pkinase PK_Tyr_Ser-Thr Mad3_BUB1_I_2
Other DBs
NCBI-GeneID: 100660153
NCBI-ProteinID: XP_010599646
LinkDB
Position
Unknown
AA seq 1084 aa
MDNAESVFQMFEAHMQNYRGDDPLGEWESYMQWVEENFPKNKEYLTTLLGHLMKEFLDKK
RYHNDPRFISYCLKFAQYNSDLHQFYEFLYNHGIGTLSSPLYIAWAGHLEGQGELQHASA
VFRRGIQNQAEPRELLQHQYRLFQKRLAETHLGAQARTSEPLHDAQVVNQTIISDSNPGK
NTGCVSENQGSQLSAVTSTTCGEESNMGQRVIVVSKSEYSTHSSLAAKTDVKQVVMYCKE
KLIRGESEFSFEELRAQKYNQRRKHEQWVNEDRHYMRRKEASAFEEQLLKQKMDELHKKL
HQVVEMSHEDLPAFQERSEVNAVRMGPRVAPQEELRGSSLPATDQQTSGNMREKPREASP
VVPLVANAVTTALAPPAVSQGAAHPLPVTAQPVADSASAAARKGASVSQEISLPRCESRS
AHEFKPQSGAEIKEACEAPKLTNTNSFHTTPNTSLGAVQATPSKVQPSPTVHTKEALGFI
MDMFQAPTLPDISDDKDDWSSLDQNEDAFEAQFQKNTKSSGVWGVNKIISSLSSAFPVFE
DGNKENYGLPQPKNKPAGARTFGERSMSRLPAKRNEVPAHTDEFLDDSTVWGIRCDKTLA
PVPKTTGDFTSAAQLASTPFHKLPVESANALEDKENMVAQQCTRVTLDCGEENTVETSKT
RKFSPIQERSPEQALPIDVPSAPVLGQSQPAAGGVLTSEAERCLEACKLTDTDVAMEEDP
PGARPAGLHAERMQSSSAGNVAASNFVVENPWDDTLILKLLSGLSKPVSTYPNTFEWQYK
LPPIKPKTEFQLGSLVIYIDHLLGEGAFAQVYEAAQDDANDAKSKQKFILKVQKPANPWE
FYIGTQLMERLKPSMQHMFIKFYSAHFFQNGSVLVGDLFSYGTLLNAINLYKNTPEKVMP
QALVISFAIRMLHMIEQVHDCEIIHGDVKPDNFILGNRFLEQDGEDDDFSAGLVLIDLGT
FAAKCETSGFQCVEMLSKKPWSYQIDYFGVAATVYCMLFGTYMKVKNEGGAWKPEGLFRR
LPHLDMWSEFFHIMLNIPDCHQLPSLDSLRQKLKKTFQQHYSNKIRTLRNRLIVLLLEYK
RSRK
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggataacgcggaaagcgtcttccagatgtttgaggcccacatgcagaactacaggggc
gatgacccgctcggtgaatgggaaagctatatgcagtgggtagaagaaaattttcctaag
aataaagaatacttgacaacattattaggacatttaatgaaagaatttttagataagaag
agataccacaatgacccaagattcatcagttattgtctgaaatttgcccagtacaacagt
gaccttcatcagttttacgagtttctgtacaaccatgggattgggaccctgtcatcgcct
ctgtacatagcctgggccgggcacctggaaggccagggagagctgcagcacgccagtgct
gtttttcggagaggaattcaaaaccaggctgaacctagagagctactgcaacaccagtac
aggttatttcagaaacgccttgccgaaactcatctgggagctcaagctagaacctcagaa
cctctgcatgatgctcaggttgtcaatcagacgataatatcagactcgaacccaggaaag
aacacaggctgtgtttctgagaaccagggttcacagctttctgcagtgacgtctacaact
tgtggtgaagagtcgaatatgggacaaagggtgatcgtggtttctaaatcagaatattct
acacattcatctttggcagccaaaactgacgttaagcaagttgttatgtattgcaaagag
aagcttattcgtggagaatcagaattctcctttgaagaactgagagcccagaaatataat
caacggagaaagcatgaacaatgggtaaatgaagacagacactatatgagaaggaaagaa
gcaagtgcttttgaagaacagctgttaaaacagaaaatggatgaacttcataagaaattg
catcaagtggtggagatgtcccacgaggacctgcccgcttttcaggaaaggtctgaggtt
aatgctgtgcgcatggggccaagggtggccccccaggaggagctgagaggatcgtctctt
cccgccacagaccagcagacctcaggcaacatgagagagaaacccagagaggcatctcct
gttgtaccccttgtggcaaatgctgtcaccactgctctggcacccccagccgtcagccag
ggggcggcccatcctcttcctgtgacagcccagcccgtggccgactctgcgtctgcagca
gccagaaaaggtgccagtgtgtctcaagagatttctcttccaagatgtgagagtagaagt
gctcatgaattcaagcctcagagtggagcagagatcaaagaagcctgtgaagcacctaag
cttactaacacaaattcttttcatacaactccaaacacatcactgggagcggtccaggca
acgccgtccaaagtgcagccgtcacccacggttcacactaaagaagcgttaggtttcatc
atggatatgtttcaggctcccaccctccctgatatttctgacgacaaagatgattggtcg
tctctagatcagaacgaagatgcatttgaagcccagtttcaaaaaaatacaaaatcttct
ggggtctggggagtcaataagattatctcttctttgtcgtctgcttttcctgtttttgag
gatggaaacaaagaaaattatggattaccacagcctaaaaataaacctgcaggagccagg
acctttggagaacggtctatgagcagacttcctgcaaaacgaaatgaagtgcccgctcac
actgacgagtttttggatgattcaactgtttggggtatccgctgcgacaaaaccctggca
cccgttcctaagaccacaggagactttacatctgctgctcagctcgcatcgaccccgttc
cacaaactcccggtggagtcagcaaacgctctagaagataaagaaaatatggtagcacaa
cagtgtacccgtgtgactttggattgcggggaagaaaacacagtggagacctcaaaaacc
agaaagttcagtccgattcaagaaagaagcccagaacaagcattacccatagatgtgccc
tcagcacccgtactcggtcagagccagcctgcggcaggtggtgtgctcaccagcgaggca
gagcggtgccttgaggcttgtaaactcacagacactgatgtcgccatggaggaagacccg
ccaggcgccaggcccgctgggctccacgcagaacggatgcagagtagctcagccggaaac
gtggctgcttcaaatttcgttgttgaaaacccgtgggatgatacgttgattctcaagctt
ttatctgggctttctaaaccagtgagcacctatccaaatacttttgaatggcagtataaa
cttccacccatcaagcccaagactgaatttcaattgggttccttggtgatctacattgat
catcttcttggagaaggagcctttgcccaagtctacgaagctgcccaggatgatgcaaat
gatgccaaaagtaaacagaaatttattttaaaggtgcagaagcctgccaacccctgggaa
ttctacattgggacccagctgatggagagactaaagccaagtatgcaacacatgtttatc
aagttctattccgcccactttttccagaacggcagcgtgttggtaggggacctcttcagc
tatgggacgctcctgaatgccattaacctctataaaaatacccctgaaaaagtgatgcct
caagctctagtcatctcttttgctatcagaatgctccacatgattgaacaagtccatgac
tgcgagatcattcatggagacgttaagccagacaacttcatccttgggaacaggttttta
gaacaggacggtgaagacgatgatttctctgcgggcttggtgttaattgacctgggtacc
tttgcagccaagtgtgaaacatctggtttccagtgtgttgagatgctcagcaagaaacca
tggagctaccagattgattactttggcgttgcagcgacggtatactgcatgctctttggc
acttacatgaaagtgaaaaacgaaggaggagcctggaagcctgaaggtctcttcagaagg
cttcctcatttggacatgtggagtgaattttttcatatcatgttgaatataccagactgt
catcagcttccatctttggattctttaaggcaaaagctgaagaaaaccttccaacaacac
tattcaaacaagatcaggaccctgcgtaacaggctgattgtgctgctcttagaatacaag
cgttcacggaagtaa

DBGET integrated database retrieval system