KEGG   Loxodonta africana (African savanna elephant): 100660199
Entry
100660199         CDS       T04351                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04611  Platelet activation
lav04720  Long-term potentiation
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04921  Oxytocin signaling pathway
lav04931  Insulin resistance
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05168  Herpes simplex virus 1 infection
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100660199 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100660199 (PPP1CB)
   04024 cAMP signaling pathway
    100660199 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    100660199 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100660199 (PPP1CB)
   04218 Cellular senescence
    100660199 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100660199 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100660199 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100660199 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660199 (PPP1CB)
   04921 Oxytocin signaling pathway
    100660199 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100660199 (PPP1CB)
   04270 Vascular smooth muscle contraction
    100660199 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100660199 (PPP1CB)
   04720 Long-term potentiation
    100660199 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100660199 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100660199 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100660199 (PPP1CB)
   05034 Alcoholism
    100660199 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100660199 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100660199 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100660199 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100660199 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:lav03019]
    100660199 (PPP1CB)
   03041 Spliceosome [BR:lav03041]
    100660199 (PPP1CB)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100660199 (PPP1CB)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100660199 (PPP1CB)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100660199 (PPP1CB)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100660199 (PPP1CB)
Spliceosome [BR:lav03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100660199 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100660199
NCBI-ProteinID: XP_003412000
UniProt: G3SW90
LinkDB
Position
Unknown
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaatgtggacagtctcatcacccgattgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttagaattggaagcaccactgaaaatt
tgtggagatattcatggacagtatacagatttactgcgattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgcttttggcttataaaatcaaatatccagagaacttctttctccta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaaggtttaatattaaattgtggaagaccttcaccgattgttttaactgtctgcctata
gcagccattgtggatgagaagatcttctgctgtcatggaggactgtcaccagacctgcag
tctatggagcagattcggagaatcatgagacccactgatgtccctgatacaggtttgcta
tgtgatttgctgtggtctgacccagataaggatgtgcaaggctggggagaaaatgatcgt
ggtgtttccttcacttttggagctgacgttgtcagtaaatttctgaaccgtcatgatttg
gacttgatttgtcgagctcatcaggtggttgaagatggatatgagttttttgctaaacga
caattagtaaccctattttcagccccaaattactgtggcgagtttgataatgctggtggg
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattctggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Loxodonta africana (African savanna elephant): 100669550
Entry
100669550         CDS       T04351                                 

Gene name
PPP1R12C
Definition
(RefSeq) LOW QUALITY PROTEIN: protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04510  Focal adhesion
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100669550 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100669550 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100669550 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100669550 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100669550 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100669550 (PPP1R12C)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100669550 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 100669550
NCBI-ProteinID: XP_010584914
LinkDB
Position
Unknown
AA seq 694 aa
MLRADPSPGAEPDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFLVEQGATVNQA
DNEGWTPLHVAASCGYLDIARYLLNHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIAHR
GVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYIEVMRLLLQAG
YDTELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLADEEVLSLLEE
LARKQEMXLRNQKEASQSRGPEPQGPSGNKHRRSSVCRLSSREKISLQDLSKERRPGGAG
GPPIRDEDEGGEGPTESSFAESKTLNGVSSPPPSIPKSPALPEGIPFPRHFGLQKTGSSG
ALGPKERWGAEGAPGAGLQRSASSSQLEGTSTQAKEPRLARITPTPSRKVLEPPALILEP
ETSVKPNAPAASTALPADSRDRRRSYQMPVRDEESESQRKARSRLMRQSRRSTQGVTLTD
LKEAEKAAGKAPEPEKPSPQSLDPARRPRVPGVENSEGPAQRAEAPDGQGPQAAGEHLKV
SKERRGPAEGEEAELAERSSVSSMPEGSPASHRQHPQQDFHPEPKPESEAQDGGFRKLYT
ELRMENERLREALTETTLRLAQLKVELERATQRQERFAERPALLELERFERRALERKAAE
LEEELKALSDLRADNQRLKDENAALIRVISKLSK
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgctgcgcgcggatcccagccccggcgccgagcccgaccccgccgccccgccgcccgcc
cgtgccgtgctcgactccactaacgccgacggcattagcgccctgcaccaggcttgcata
gatgagaatctggaggtggtgcgcttcctggtggagcagggcgccactgtgaaccaggcg
gacaacgagggctggacgcccctgcacgtggctgcctcctgtgggtatctggacattgcc
aggtacctcctgaaccacggggccaacattgctgccgtcaacagcgatggtgacctgccc
ctggacctggctgagtcggacgccatggaggggttgctgaaggcggaaattgcccaccga
ggtgtggacgtggaggcagccaagcgggccgaggaggaactgctgcttcatgacacgagg
tgctggctgaacgggggcgccatgccagaggcccggcacccccgcactggagcttctgcc
ctgcatgtggctgccgctaagggctacatagaggtgatgaggctgctccttcaggctggc
tatgacacggagctccgggacggcgatggctggactcccctacacgctgcagcccactgg
ggcgtggaggatgcctgccgtttactggctgagcacggtgggggcatggactcactgacc
catgcggggcagcgtccctgtgaccttgctgatgaggaggtactaagtctgctggaggaa
ctggcccgaaagcaggagatgtgactacggaaccagaaggaagcttcccagagcaggggc
cctgagccacagggcccctctggcaacaaacaccgcaggagctctgtgtgtcgtctgagc
agccgagagaagatctcccttcaggacctgtcaaaggagcgccggccggggggagcggga
gggccccccatccgggatgaggatgagggaggagaaggccctacagagtcctcctttgca
gaaagcaaaaccctcaacggagtctcctctccaccaccctccatccctaagagccccgcg
ctgcccgaaggaatccctttccccaggcacttcggcctccagaagacggggagctcaggt
gccctgggccccaaagaaaggtggggggctgagggtgcccctggggctggactgcagcgc
tcagcgtcctcctctcagctggaaggcacctccactcaggccaaggagccgcgtcttgcc
agaatcacccctacgccctcccggaaggtgctggaaccccctgccctaattctggaacct
gaaacctcagtgaagccaaatgcccctgcagcctccacagcactcccagcagactcccgg
gaccgcaggaggtcctaccagatgccagtgcgtgatgaggagtctgaatcccagcggaaa
gctcgctctcgcctcatgcgccagtctcggaggtctacacagggtgtgactctgacggac
ctgaaggaggcagagaaggccgcagggaaggccccagagccagagaagccgtccccacag
agcctggaccctgctcggaggccccgagtccctggtgtcgagaactctgagggccctgca
cagagagcagaggcgcctgacgggcagggaccacaggccgccggggagcacctcaaagtc
agcaaggaacgcagggggcctgcggagggggaggaggcggagctggcagagcgaagctcg
gtatccagcatgcctgaaggcagccccgcatcccacaggcagcacccccagcaggacttc
cacccagagcccaagccagagtctgaggcgcaggatggaggttttcggaagctgtacaca
gagttgcgtatggaaaatgaacggctgcgtgaggccctgacggagaccacactgcggctg
gcgcagctcaaggtggagttggagcgtgccacgcagaggcaagagcgtttcgctgagagg
cctgcccttctggaactggagagattcgagcgccgggccttagagcggaaggctgcagaa
ctggaggaggagctgaaggccctgtcggacctccgcgctgacaaccagcggctcaaggac
gagaacgcagccttgattcgagtcatcagcaagctctccaagtga

KEGG   Loxodonta africana (African savanna elephant): 100671604
Entry
100671604         CDS       T04351                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04611  Platelet activation
lav04720  Long-term potentiation
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04921  Oxytocin signaling pathway
lav04931  Insulin resistance
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05168  Herpes simplex virus 1 infection
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100671604 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100671604 (PPP1CC)
   04024 cAMP signaling pathway
    100671604 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    100671604 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100671604 (PPP1CC)
   04218 Cellular senescence
    100671604 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100671604 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100671604 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100671604 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100671604 (PPP1CC)
   04921 Oxytocin signaling pathway
    100671604 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100671604 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100671604 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    100671604 (PPP1CC)
   04720 Long-term potentiation
    100671604 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100671604 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100671604 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100671604 (PPP1CC)
   05034 Alcoholism
    100671604 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100671604 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100671604 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100671604 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100671604 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:lav03019]
    100671604 (PPP1CC)
   03041 Spliceosome [BR:lav03041]
    100671604 (PPP1CC)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100671604 (PPP1CC)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100671604 (PPP1CC)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100671604 (PPP1CC)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100671604 (PPP1CC)
Spliceosome [BR:lav03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100671604 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100671604
NCBI-ProteinID: XP_023394966
LinkDB
Position
Unknown
AA seq 269 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLHSLS
KVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATR
PVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcggatatagacaaactcaacatcgacagcatcatccaacggctactggaagtgaga
gggtccaagcctggtaagaatgtccagttacaggagaatgaaatcagaggactgtgctta
aagtctcgggagatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgcttcgactttttgagtatggtggt
ttcccaccagaaagcaactacctgtttcttggggactatgtggacagggggaagcagtca
ttggagactatctgcctcttactggcctacaaaatcaaatatcccgagaacttttttctt
ctcagaggaaaccatgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactctggaaaacattcacagactgctttaactgtttaccg
atagccgccatcgtggatgagaagatattctgctgtcatggaggtttacattctctctcc
aaggtggttgaagatggttatgaattttttgccaagaggcagttggtcactctgttttct
gcacccaattattgtggagaatttgacaatgcaggtgccatgatgagtgtggatgaaacg
ctcatgtgttcttttcagattttaaagcctgcagagaaaaagaagccaaatgccactaga
cctgtaacaccaccaagggttgcatcaggcctgaacccgtccattcagaaagcttcaaat
tatagaaacaatactgtcctatacgagtga

KEGG   Loxodonta africana (African savanna elephant): 100673814
Entry
100673814         CDS       T04351                                 

Gene name
PPP1CA
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04611  Platelet activation
lav04720  Long-term potentiation
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04921  Oxytocin signaling pathway
lav04931  Insulin resistance
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05168  Herpes simplex virus 1 infection
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100673814 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100673814 (PPP1CA)
   04024 cAMP signaling pathway
    100673814 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    100673814 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100673814 (PPP1CA)
   04218 Cellular senescence
    100673814 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100673814 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100673814 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100673814 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100673814 (PPP1CA)
   04921 Oxytocin signaling pathway
    100673814 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100673814 (PPP1CA)
   04270 Vascular smooth muscle contraction
    100673814 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    100673814 (PPP1CA)
   04720 Long-term potentiation
    100673814 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100673814 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100673814 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100673814 (PPP1CA)
   05034 Alcoholism
    100673814 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100673814 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100673814 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100673814 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100673814 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:lav03019]
    100673814 (PPP1CA)
   03041 Spliceosome [BR:lav03041]
    100673814 (PPP1CA)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100673814 (PPP1CA)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100673814 (PPP1CA)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100673814 (PPP1CA)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100673814 (PPP1CA)
Spliceosome [BR:lav03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100673814 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 100673814
NCBI-ProteinID: XP_010597309
LinkDB
Position
Unknown
AA seq 330 aa
MSDTEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacaccgagaagctcaacttggactccatcatcgggcgccttctggaagtgcaa
ggctcacggcctgggaagaatgtccagctgacagagaacgagatccgtggtctgtgtctc
aagtcgagggagatcttcttgagccagcccattcttctggagctggaggcgcccctcaag
atatgtggtgacatccacggccagtactatgaccttctgcggttgtttgagtacggcggc
tttcctccggagagcaactacctcttcctgggggactacgtggaccggggcaagcagtct
ctggagaccatctgtctgctgctggcctataagatcaagtaccccgagaactttttcctg
ctccgtgggaaccacgagtgtgccagcatcaaccgcatctacggcttctatgacgagtgc
aagagacgctacaacatcaagctgtggaaaaccttcaccgactgcttcaactgcctgccc
atcgcggccattgtggatgagaagattttctgctgccatggaggcctatccccagacctg
caatccatggagcagatccggcggatcatgcggcccaccgatgtgcctgaccagggcctg
ctgtgcgacctgctgtggtctgaccccgacaaggacgtgcagggctggggcgagaacgac
cgcggtgtctcctttaccttcggggccgaggtggtggccaagttcctgcacaaacatgac
ttggacctcatttgccgggcgcatcaggtggtggaagacggctacgagttctttgccaag
cggcagctggtgacacttttctcagctcctaactactgtggcgagtttgacaacgctggt
gccatgatgagtgtggatgagactcttatgtgctccttccagatcctcaaacccgccgac
aagaacaaggggaaatacgggcagttcagcggcctgaatcctggaggccggcctatcacc
ccaccccgcaattctgccaaagccaagaaatag

KEGG   Loxodonta africana (African savanna elephant): 100673922
Entry
100673922         CDS       T04351                                 

Gene name
PPP1R12A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A isoform X2
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04270  Vascular smooth muscle contraction
lav04510  Focal adhesion
lav04611  Platelet activation
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100673922 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    100673922 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100673922 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100673922 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100673922 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100673922 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100673922 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100673922 (PPP1R12A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100673922 (PPP1R12A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100673922 (PPP1R12A)
SSDB
Motif
Pfam: Ank_2 PRKG1_interact Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 100673922
NCBI-ProteinID: XP_003405269
UniProt: G3TDK0
LinkDB
Position
Unknown
AA seq 1030 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVSQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASCIESLEQEKVDEEEEGKKDESSCSSEED
EEDDSESEAETDKTKPLTSVTNINTSSTQAATVAVTTPTVTSGQATPTSPIKKFPTSAAK
ISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVMRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSINEGQTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTS
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPASTSSSTTP
SSSLSTMSSSLYTSSQLNRPNSLVGITSAYSRGLTKENEREGEKREEEKEGEDKSQTKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKRETETDSISRYETSSTSASDR
YDSLLGRSGSYSYLEERKPYSSRLEKEDPTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctcctgtggtgaagcgtcagaagaccaaggtgaagttcgacgat
ggcgccgtcttcctggctgcttgctcaagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggacttaccgctctgcaccaggct
tgcattgatgataatgttgatatggtgaagtttctggtagaaaacggagcaaatattaat
caacctgacaatgaaggctggataccactacacgcagctgcttcctgtggatatcttgat
attgcagagtttttgattggtcagggagcacatgtaggcgctgtaaacagtgaaggagac
acacctttagatattgctgaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaggaagaagaacggataatgcttagagat
gcaagacagtggttaaatagtggtcacataaatgatgtccgacatgcaaagtctggaggt
acagcacttcatgtagcagctgctaaaggctatacagaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcgaattttagtggacaatctgtgtgatatggagatg
gtcaacaaagtgagccagacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgagataagaaatctcca
ttaattgaatcaacagctaatatggacaataatcagtcacagaagacttttaagaacaaa
gagacattgattattgagccagagaaaaatgcatcctgtattgaatctctggaacaagaa
aaggttgatgaagaagaagaaggaaagaaagatgaatctagctgctctagtgaagaagat
gaggaagatgactcagaatcagaagctgaaacagataagacaaaaccattgacttctgta
actaatatcaatacttctagtacacaagcagctactgtagctgtcacaacacctactgtg
acgtctggtcaggcaacacctacatcacctattaaaaagttcccaacctcagctgctaaa
atctctcccaaagaagaagaaaggaaagatgaatctcctgcatcttggaggttaggactt
agaaagactggcagctatggtgcacttgctgaaatcacagcatctaaagaggctcagaaa
gaaaaagacactgcaggtgttatgcgctcagcttcaagtcccagactttcctcctctttg
gataataaagaaaaggagaaagacagtaaaggaactaggctcgcatatgtggcacctaca
ataccaagacgactagccagtacatctgacattgaagagaaagaaaacagagactcttca
agtttgcgaacaagtagttcttacacgagaagaaaatgggaagatgatctcaaaaagaat
agctcaattaatgaaggacaaacctatcataaaagttgctcctttggtagaagacaagat
gatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagct
gggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttct
tcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgaa
aaagaaaaggacagtgttcctacggcagtgaccattcctgttgctccaactgttgtaaat
gctgcagcttctaccacaaccctgactacaactactgctggcactgtctcctccacatca
gaggtcagggagagacgcagatcatacctcactcctgttagggatgaagagtcagaatcc
caaagaaaagcaagatctagacaagcaagacagtctagaagatcaacacagggggtgaca
ttgactgatcttcaagaggctgaaaaaacaataggaagaagtcgctctacccgaaccaga
gaacaagaaaatgaagaaaaagagaaagaggaaaaagaaaaacaggataaagagaagcaa
gaagaaaagaaggagtcagaaacatctagggaagatgaatataaacagaaatactccaga
acatatgatgagacttaccagcgttacagaccagcatcaacttcaagttcaaccactcca
tcttcttcactttctaccatgagcagttcactctacacttcaagtcaactaaacaggcca
aatagtcttgtaggtataacttctgcttactccagaggattaacaaaagaaaacgaaaga
gaaggagaaaaaagagaagaggaaaaagaaggagaagataaatcacaaactaaatcaatc
agagaacgacggcgaccaagagagaaaagaagatctactggagtttcattttggacacaa
gatagtgatgaaaatgaacaagaacaacaatcagatacagaagagggatccaataagaga
gagactgagacggattccatctcaagatatgaaaccagttccacatcagcgagtgatcgg
tatgattccttgctgggtcgctctggatcatacagctacttagaagaaagaaaaccttac
agtagcaggctagaaaaagaggatccaactgattttaaaaagctttatgaacaaatcctg
gctgaaaatgaaaagctaaaggcacagctgcatgacacaaacatggaactaacagatctt
aaattgcaattggaaaaggccacccagagacaagaaagatttgctgataggtcactattg
gaaatggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagag
ctcaaaatgttaccagatctaaaggcagacaaccagaggctaaaggatgaaaatggggcc
ttgatcagagttataagcaaactttccaaataa

KEGG   Loxodonta africana (African savanna elephant): 100675940
Entry
100675940         CDS       T04351                                 

Gene name
PPP1R12B
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B isoform X3
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04510  Focal adhesion
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675940 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100675940 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100675940 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675940 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100675940 (PPP1R12B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100675940 (PPP1R12B)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100675940 (PPP1R12B)
SSDB
Motif
Pfam: Ank_2 PRKG1_interact Ank_4 Ank_5 Ank_3 Ank MEDS
Other DBs
NCBI-GeneID: 100675940
NCBI-ProteinID: XP_003410276
LinkDB
Position
Unknown
AA seq 975 aa
MAELEHLGGKRAESARTRRAEQLRRWRGSLTEQEPAERRGAGRQSQSRRGSPRVRFEDGA
VFLAACSSGDTDEVKKLLARGADINTVSVDGLTALHQACIDENLDMVKFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKLQSGLFKNKEKMLYEEETPKSQEMEEENKESSSS
SSEEEEGEDEASESETEKEADKKPDAIVNHSNSESKSSITEQIPTPAQNTFSASSRRFSS
SLFNKPEEPKDESPSSWRLGLRKTGSHNMLTEVANSRETLRDRGSSVYRSSSSPRISAVL
DNRDKERENKSYFGSLASRRLSSTSDIEEKENRESAVNLVRSGSYSRQLRRDEAKGNETP
ETVAPSTYVSTYLKRTPYKPQADSTAEKTADNVSSSTPLCVITNRPPPSTANGVTAASVL
STTGTDSSVEAREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERTF
SRSRAERQAQEQPGEKPVDTEGLEGCSEKSEPSAVPAKEVGEGRQPWVGSLDEESVYRRL
RCPAKPDKPTTPVSPSGSRPSLYTSSYLLQTSRSSVPDSENSETTTNIAKEMDKNESEEA
DLDTQSSNRLSSRDRRRPKERRRGTGINFWTNDGDEADVSEEVKQALHERLSRLESGGSN
PTSSESYDRASARARREARLASLTSRVEEDSNRDYKRLYESALTENQKLKTKLQEAQLEL
ADVKSKLEKMAQQKQEKTSDRSSMLEMEKRERRALERKMSEMEEEMKVLTELKSDNQRLK
DENGALIRVISKLSK
NT seq 2928 nt   +upstreamnt  +downstreamnt
atggcggagctggagcacctaggcgggaagcgggcagagtcggcgcgaacgcggcgggct
gagcagcttcggcgctggcggggttcgctgaccgagcaggagcccgcggagcggcgaggc
gcgggacggcagtcgcagagtcgtcgcgggagccccagggtccgcttcgaggacggtgct
gtcttcctggccgcctgttctagtggggacaccgacgaggtgaaaaagcttctggctagg
ggagccgacatcaacaccgtcagcgtggacggcttgacagccctgcaccaggcctgtatt
gatgaaaatttggacatggtgaagtttctggtggagaatagagccaatgtaaaccagcag
gacaacgagggctggaccccccttcacgcggcagcttcctgtggctatctcaacatagca
gaatatttcattaaccacggagccagtgtgggtattgtgaatagtgaaggtgaagtccct
tctgaccttgcagaagagccagccatgaaggatcttctcctggagcaagtgaagaagcaa
ggagttgacctagagcagtcaagaaaagaagaagaacaacaaatgttgcaggatgcccgc
cagtggctcaacagtgggaaaatagaggatgtgaggcaggcccgctcaggggccacagcc
ctccatgtggccgctgccaagggctactccgaggttctcagacttttaattcaggctggc
tatgaactcaatgttcaggatcatgatggctggaccccccttcatgctgctgcacactgg
ggagtgaaggaggcttgctccatcctggcagaagcactctgtgacatggatatcaggaac
aaactgggccagaccccatttgatgtggctgatgagggtcttgtggagcacttggagatg
ctccagaagaagcagaatgtgcttcgaagtgaaaaagagacgcggaataaactcattgag
tcagacctgaacagcaagttgcagagtggactctttaagaacaaggagaagatgctctat
gaggaagagacacccaagtcccaagaaatggaggaagaaaacaaggaatccagcagctcc
agttcagaggaggaagaaggtgaagatgaagcttctgagtcagaaactgagaaggaggca
gataaaaagccagatgccattgtcaaccattccaactctgaaagcaagagtagtatcacc
gagcaaataccaacaccagctcagaacaccttctctgcctcttctaggagattctcctcc
agcctttttaacaagccagaagagcccaaagatgaatctccttcttcctggagactggga
ctcagaaaaactggcagccacaacatgctgactgaggtggccaattccagggagactcta
agagaccgaggctcctctgtctaccgttcatcatcaagccctcgaatttctgctgtactg
gacaacagagataaggagagagaaaacaaaagctattttggttcactagcatccaggagg
ctcagcagcacaagtgacattgaagaaaaggagaacagagagtcagctgttaatctagtg
aggagtggttcctactcccgacagctgcggagggatgaagcaaagggaaatgaaaccccg
gaaacagttgctccttccacctatgtgtcaacgtacttgaaaaggactccctacaaaccc
caggctgactcgacagcagagaaaacagcagacaatgtctcttctagcacccccctctgc
gtgatcaccaatcgccccccacctagcactgccaatggggtcacagctgccagtgtgctc
tcaactactgggacagactcgtccgtggaagccagggagaagaggaggtcatatctgact
cctgtacgggatgaggaagcagagtctttacggaaagcacgctccagacaagctcggcag
actcgaaggtctactcaaggtgtaaccctaacagaccttcaagaggcagaaagaactttc
agccggtcgagggcagagcggcaagctcaggagcagcctggcgagaagcctgtagacacc
gaagggcttgagggctgctcggagaagagtgagccttcagcagtgccggcaaaggaggtt
ggggagggccgacagccgtgggttggaagcctggatgaagagtctgtctatcgtcgcctg
aggtgtccagctaagccagacaaacccacaacaccagtatctccctctggatcaagacct
tcactctacaccagttcctatctgctacaaacaagtaggtcttcagtccctgattctgag
aattcagagaccaccacaaacattgcaaaggaaatggacaaaaatgagagcgaagaagca
gatttagatactcagtcctccaacaggctgtccagccgagacaggaggcgacccaaggaa
cggcgaagaggcacgggcatcaacttctggacaaacgacggggatgaagctgatgtctcc
gaagaggtgaaacaggcactgcatgaaagactttctaggttggagtcaggaggtagcaac
cctacaagcagtgaatcttatgaccgagcctcagcaagagcccggcgggaggcccgtctg
gccagcctgaccagccgggtagaagaggacagcaacagggattataagagactctacgag
agtgccctaaccgaaaaccaaaaactgaaaacaaaactgcaggaggcccagctagagcta
gcagatgtaaaatccaagcttgagaagatggcccagcagaaacaagagaagacctctgac
cggtcgtcgatgctggagatggagaagcgggagaggagagccttggagcggaaaatgtcg
gaaatggaggaggagatgaaggtgttaacagagctgaaatctgacaaccagaggctgaaa
gatgaaaacggtgctctcatcagagtcatcagcaaactgtccaagtag

DBGET integrated database retrieval system