KEGG   Loxodonta africana (African savanna elephant): 100660332
Entry
100660332         CDS       T04351                                 

Gene name
CACNA1I
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04713  Circadian entrainment
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100660332 (CACNA1I)
   04020 Calcium signaling pathway
    100660332 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100660332 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    100660332 (CACNA1I)
   04927 Cortisol synthesis and secretion
    100660332 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100660332 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100660332 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100660332 (CACNA1I)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100660332 (CACNA1I)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 100660332
NCBI-ProteinID: XP_023415750
LinkDB
Position
Unknown
AA seq 1790 aa
MPPQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFDSIIVIISIWEIV
GQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILG
MHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASL
YFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSSSNMEEFDKLQEGLDSGGG
KQASTGHPGGQDPSGDPGGERAQHLASPSRPGSGEVHVVGSKREDFLVEDPKLCPAPMTP
NGHLDPSLPLGGHLGPTGGMAPTPRLSLQRDPVLVALGSRKSSVMSLGRMSYDQRSLGLM
GRDRLPVGTSCPNRGSVCGALTGAPASSQSSSRSSYYGPWGRSGTWASRRSSWNSLKHKP
PSAEHESLLSAERGGGARACEGARDEGPPRAAPLHAPHAHHAHRGPHVAHRHRHHRRTLS
LDTRDSVDLAELGPAGGAHPRTAWRAAAPAPGHEDCNGRMPSIAKDVFTKMNDRGDREED
EEEIDYVSVGRAWGRDQKAGQEISGRGPRGRLEWEGSEGRGIRGVALGWSGGSGLAGRVS
GRDSVPTVRWMPRVGGGRKLWAALTHPALSSPRQTLCFRVRKMIDAYKPEWCQVREDWSV
YLFSPENRFRVLCQTIIAHKLFDYVVLGFIFLNCITIALERPQIEAGSTERIFLTVSNYI
FTAIFVGEMTLKVVSLGLYFGEEAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGV
LRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKG
KFYHCLGVDTRNITNRSDCMAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGL
DAVAVDQQPVTNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRRE
EKRLRRLEKKRRKAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYN
QPTSLEIALKYCNYLFTTVFVLEAVLKLVAFGLRRFFKDRXRDLPDLPLCYFQVMGITLE
EIEINAPLPINPTIIRIMRFLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLL
FFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLR
DCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAE
IELEIAHSLGPSLGPGLRPPTSSPGAPSHGPGGAGGGGDPEGHLSQRCYSPAQENLWLDS
VSLIIKDSLEGELTIIDNLSGSVFHHYSSTASCEKCHHDKQEVQLAETEAFSLNSDRSSS
ILLGDGLSLEDLTAYPPGPKDGTGEPDLPEPVRVGDLGECVCPLSNTAVSSGPENYLCEV
EAIPFNPVRSWLKHESGQAAPPNPFSLEASSPLLPMPAEFFHPAVSAGQKGQEKVAGPGT
LPKIALQGSWASLRSPSVNCTLLRQATESDTSLDASHSSSVGSLQTTLEDSLTLSDSPRR
ALGPPMPALGPRASLSPAARRRLSLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDEEGGR
AGAGGGGAGSEHSETLSSLSLTSLFCPPPPPPPPGLRPARKFSSTSSLAAGPGRPRAASG
LPQGLPRSPSWAADRSKDPPGQAQQGHRPGPLGSPSRSPPPGELGELEAGFAATKRKRWR
GPWGQAGRHRLPAPSHFFLPQEPGSRQQYFVPHLGIMQGPASRQAAERGD
NT seq 5373 nt   +upstreamnt  +downstreamnt
atgcccccacagcccgaggagctgaccaacatcctggagatctgcaacgtggtcttcacg
agcatgttcgccctggagatgatcctgaagctggctgccttcgggctcttcgactacctg
cgcaacccctacaacatcttcgacagcatcattgtcatcatcagcatctgggagatagtg
gggcaggcagacggcggcctgtcggtgctgcggaccttccggctgctgcgggtgctgaag
ctggtgcgcttcatgcccgcgctgcggcgccagctggtggtgctcatgaagaccatggac
aatgtggccaccttctgcatgctgcttatgctcttcatcttcatcttcagtatccttggg
atgcacatctttggctgcaaattcagcctccgcacggacacaggtgacacagtccccgac
aggaagaactttgactccttgctgtgggccattgtaacggtgttccagatcctcacccag
gaggactggaatgttgtcctctataacggcatggcctccacctccccgtgggcctccctc
tactttgtcgccctcatgaccttcggcaactacgtgctcttcaatctgctggtggccatc
ctggtggagggcttccaggcagagggtgacgccaatcgctcctactcagatgaggaccaa
agctcatccaacatggaggagtttgacaagctccaggagggcctggacagcgggggaggt
aagcaggcctccactggtcacccagggggtcaggacccttccggggatccaggtggggaa
agggcacagcacctggcttccccctcaaggccaggcagtggggaggtgcatgtggtgggg
tccaagcgggaagacttcctggtggaggaccccaagctctgcccagcccccatgaccccc
aatgggcacctggaccccagtctcccactgggtggccatctgggccccactgggggcatg
gcccccaccccccgcctctcactgcagcgggaccctgtgctggtggctctgggctcccgc
aagagcagcgtcatgtcactggggaggatgagctatgaccagcgctccctgggcctcatg
gggcgggaccggctgccagtgggcacctcttgtccgaaccgtgggagcgtgtgtggggcc
ctgacgggagccccggcctcctcccagtccagctcccggagctcctactacgggccgtgg
ggccgcagcgggacctgggccagccgccgctccagctggaacagcctcaagcacaagcca
ccgtcggccgagcacgagtccttgctctcggccgagcggggtggcggcgcccgggcctgt
gagggcgcccgtgacgaggggccgccgcgagccgccccgctgcacgccccgcacgcgcac
cacgcgcaccgtggcccgcatgtggcgcaccgccaccgccaccaccgccggacgctctcc
ctcgacaccagggactcggtggacctggccgagctggggcccgcggggggcgcccacccc
cggacagcctggagggcggcggccccggccccggggcacgaggactgcaatggcaggatg
cccagcatcgccaaggacgtcttcaccaagatgaatgaccgcggggatcgcgaggaggat
gaggaggagatagactacgtgagtgtgggcagggcctgggggcgggaccagaaggctggc
caagaaattagtgggcggggccccaggggcaggctggagtgggagggctctgaggggcgt
ggcattaggggcgtggcccttgggtggagtggagggtctggacttgctggaagagtgtcg
ggacgcgattcagtgcctacagttcgttggatgccccgagtgggcggaggtaggaagctc
tgggcagcgctgacccaccctgccctgtcctcccctcgccagactctgtgcttccgggtc
cgaaaaatgatcgacgcttacaagcccgaatggtgccaggtcagagaggactggtccgtt
tatctcttctcccctgagaacaggttccgggtcctatgccagaccatcatcgcccacaag
ctctttgactatgtcgtcctgggcttcatcttcctcaactgtatcaccatcgccctggag
cggcctcagatcgaggcgggcagcacagaacgcatcttcctcactgtgtccaactacatc
ttcacagccatctttgtgggcgagatgacactgaaggtggtctctctcggcctgtacttt
ggcgaagaggcgtacctgcgcagcagctggaacgtgctggatggcttcctcgtcttcgtg
tcgatcatcgacatcgtggtgtctgtggcctcggccgggggagccaagatcctgggggtt
ctccgggtccttcggctcctgcgcaccctacgccccctacgggtcatcagccgggcaccc
ggactgaagctggtggtggagaccctcatctcctctctcaagcccattggcaacattgtc
ctcatctgctgtgccttcttcatcatcttcggcatcttgggggtgcagctcttcaagggc
aagttctaccactgcctgggtgtggacacccgcaacatcaccaaccgctctgactgcatg
gccgccaactaccgctgggtgcatcacaaatacaactttgacaacttgggtcaggccctg
atgtccctctttgtcctggcctccaaggacggctgggtgaacatcatgtacaatggactg
gacgctgttgctgtggaccagcagcccgtgaccaaccacaacccgtggatgctgctgtac
ttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatgtttgtgggcgtcgtc
gtggagaacttccacaagtgccggcagcaccaggaggccgaggaggcgcggcggcgtgag
gagaagcggctgcggcgccttgaaaagaagcgccggaaggcccaacggctaccttactat
gctacctactgcccgacccggctgctcatccactctatgtgcaccagccactacctggac
atcttcatcaccttcatcatctgcctcaacgtggtcaccatgtccctggagcactacaac
cagcccacgtccctggagatagccctcaagtactgcaactacctgttcaccactgtgttt
gtgctggaggctgtgctgaagctggtggcatttggcctgaggcggttctttaaggaccgg
taacgagatctaccggacctgccattgtgctactttcaagtgatgggcatcacgctggag
gagatcgagatcaatgcaccattgcccatcaaccccaccatcattcgcatcatgcggttt
ttgcgcatcgcccgggtgctgaagctgttgaagatggccacaggcatgcgggctctgctg
gacacagtggtgcaggctctgccccaggtgggcaacctgggtctcctgttcatgctgctg
ttcttcatctatgccgccctgggtgtggagctctttgggaagctggtctgcaatgacgag
aacccatgtgagggcatgagccggcacgccaccttcgagaacttcggcatggccttcctc
acgctcttccaggtctccaccggcgacaactggaacgggatcatgaaggacacgcttcgg
gactgcacacacgacgaacgtagctgcctgagcagcctgcagttcgtgtcgccgctgtac
ttcgtcagcttcgtgctcactgcccagttcgtgctcatcaacgtggtggtggccgtgctc
atgaaacacctggatgacagcaacaaagaggcccaggaggacgccgagatggatgccgag
atcgagctcgagatagcccacagcctgggccctagcctgggccctggcctgcggccgccc
accagctccccaggggcacccagccatgggccaggtggggcaggtggtgggggcgacccc
gagggccacctgagccagcgctgctactctccagcccaggagaacttgtggctggacagc
gtctctttaatcatcaaggactccttggagggggagctgaccatcatcgacaacctgtct
ggctctgtcttccaccactactcctctaccgccagctgcgagaagtgtcaccatgacaag
caagaggtacagctggctgagacagaggccttctccctgaactctgaccggtcctcgtcc
atcctgctgggtgatggcctgagtctcgaggacctcacagcctacccgcctggccccaaa
gatggcacgggtgagccagacctgcctgagcccgtccgtgtgggggacctgggcgaatgc
gtctgccccttgtccaatacggctgtctcgtcaggcccagagaactacctgtgcgaggtg
gaggcgatcccattcaaccctgtccggtcctggctgaaacatgagagtggccaagcagcg
ccccccaaccccttctccctggaggcgtccagcccactcctgcccatgcctgctgagttc
ttccacccagctgtgtccgctggccagaaagggcaggagaaggtcgccggccctgggacc
ctcccaaagatcgctctgcagggctcctgggcctccctgcggtccccgagcgtcaactgc
acccttctccggcaggccacagagagtgacacgtcgctggatgccagccacagcagctca
gtgggcagcctgcagaccacgctggaggacagcctgaccttgagcgacagtccccggcgt
gctctggggccgcccatgcctgcactgggcccccgggccagcctgtcgcccgctgcccgc
cgccgcctcagcctgcgcgggctccgggcacaccagcgcagccacagcagtgggggctcc
accagccctggctgcacccaccacgactccatggacccttcagacgaggagggaggccgg
gccggtgcgggcggtgggggcgcgggcagcgagcactcggagaccctcagcagcctctcg
ctgacctccctcttctgcccgccgcccccaccaccgccccccggtctcaggccggccagg
aagttcagcagcaccagcagcctggccgctggccctggccgccctcgcgccgcctcgggc
ctgccccaaggcctgccccggagcccctcgtgggctgcagaccgcagcaaggacccaccg
ggccaggcccagcagggccataggcctggcccccttggaagcccgagccgcagcccaccc
ccgggggagctgggggagctggaggcagggtttgctgcaaccaagaggaagagatggagg
gggccatggggccaagccggacgccaccgcctgcccgccccgtctcacttctttttacct
caggagccagggagcagacagcaatactttgtcccacacctgggaattatgcaggggcca
gccagccgccaggccgccgagaggggagattga

KEGG   Loxodonta africana (African savanna elephant): 100666554
Entry
100666554         CDS       T04351                                 

Gene name
CACNA1G
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G isoform X1
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04713  Circadian entrainment
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100666554 (CACNA1G)
   04020 Calcium signaling pathway
    100666554 (CACNA1G)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100666554 (CACNA1G)
   04925 Aldosterone synthesis and secretion
    100666554 (CACNA1G)
   04927 Cortisol synthesis and secretion
    100666554 (CACNA1G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100666554 (CACNA1G)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100666554 (CACNA1G)
   04934 Cushing syndrome
    100666554 (CACNA1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666554 (CACNA1G)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100666554 (CACNA1G)
SSDB
Motif
Pfam: Ion_trans PKD_channel SieB
Other DBs
NCBI-GeneID: 100666554
NCBI-ProteinID: XP_003414668
LinkDB
Position
Unknown
AA seq 2385 aa
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLQQPCFLDCSGTWFERISMLVILLNCVTLGMFRPCEDIACDSQRCR
ILQAFDDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVS
FSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG
LLRNRCFLPENFSLPLSVDLERYYQTDNEDESPFICSQPRENGMRSCRSVPTLRGEGGGG
PPCGLDYDAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEG
WVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVR
FLSNASTLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAVGVRVGLLNSPVAHGGQE
SLPSGSCSRSHRRPSVHHLVHHHHHHHHHYHLGNGTLRAPRSSPEIQDREANASRRLMLP
PPSTPALSAGPPGGTESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVQT
SSPPELLKEKALVEVAPASRPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCL
KADRGACGPDSCPYCARVGPGEAELADHEVPDSDSEAVYEFTQDTQHGDLRDPHSQRRRS
LGPNAEPSSVLAFWRLICDTFQKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNAL
EISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRT
FRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASER
DGDTLPDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVL
FNLLVAILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDATKSESEPDFFSPSLEGNGD
RKKCLALASLGEHPELRRSLLPPLIIHTAATPTSLPKSSSTGLAEPLGPASRRTSSSWSA
EPGVAQEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGE
GRESQDEEDSSEEERATPAGSNRRHRESLEREAKGSFDLPDTLQVPGLHRTASGRSSASE
HQDCNGKSAPGCLARVLHPDDPPLDGDDADDEGNLSKGERMRAWIRARLPACCQERDSWS
AYIFPPQSKFRLLCHRIITHKMFDHVVLIIIFLNCITIAMERPQIDPHSAERIFLTLSNY
IFTAVFLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISIIDILVSLVSDSGTKILG
MLRVLRLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFK
GKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDG
LDAVGVDQQPVMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRR
EEKRLRRLEKKRRNLMLDDVIASGSSACAAPEAQCKPYYSDYSRFRLLVHHLCTSHYLDL
FITGVIGLNVVTMAMEHYQQPQILDEALKICNYVFTIIFVLESVFKLVAFGFRRFFQDRW
NQLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDT
VMQALPQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTL
FRVSTGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLE
ESNKEAKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPNPGALHPAAHA
RAASRFSFEHPTDRQLFDTISLLIQGSLEGELKLMDELASPGGQPSAFPPAPSPGGSDPQ
IPLAEMEALSLTSEIVSEPSCSLALTDDSLPDDTHILLLSALESNMQPHPEEVPVTLGLD
LLTVRKSGVSRTHSLPNDSYMCRDGSAAEGSPGHRGRGLPKAQSGSVLSIHSQPADTSYI
LKLPKDAPHLLQPHSTPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDL
LSEVSGPSPPLARATSFWGQTSIQVQQHARSQSKILKHMPPPAPRPGPEPIWAKGPPETS
SSLELDTELSWISGDLLTVSSQEESPSPRDLKKCYSVEAQSCRRRPASWLDEQRRHSIAV
SCLDSGSQPHLSPGPSSLGAQTLGGPGSRPKKKLSPPSISIDPPESQGPRPPPSPGVCLR
RRAPSSDSKDPSASGPPDSMAASPPPKKDVLSLSGLSSDPTDPDP
NT seq 7158 nt   +upstreamnt  +downstreamnt
atggacgaggaggaggatggagcgggcgccgaggagtcgggacagccccggagcttcatg
cggctcaacgacctgtcaggggccgggggccggccggggccggggtcggcggagaaggac
cccggcagcgcggactccgaggcggaggggctgccgtacccggcgctggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccaacagccctgtttc
cttgactgctctggtacctggtttgagcgcatcagcatgttggtcatcctgctcaactgt
gtgaccctgggcatgttccggccatgtgaggacattgcctgtgactctcagcgctgccgg
atcctgcaggcctttgatgacttcatctttgccttcttcgccgtggagatggtggtgaag
atggtggccttgggtatcttcgggaaaaagtgttacctgggagacacttggaaccggctt
gactttttcatcgtcattgccgggatgctggagtattccctggatctgcagaatgtcagc
ttctcagctgtcaggacagtccgtgtgcttcgaccgctcagggccattaaccgggtgccc
agcatgcgtatccttgtcactctgctgctggacaccctgcccatgctaggcaacgtcctg
ctgctctgcttcttcgtcttcttcatctttggcatcgttggtgtccagctctgggctggg
ctgctccgtaaccgatgcttcctgcctgaaaatttcagcctccccctgagtgtggacctg
gagcgctattaccagacggacaatgaggacgaaagccccttcatctgctcccagccgcgt
gagaatggcatgcggtcctgccggagcgtgcccacactgcgtggggaggggggcggcggc
ccaccctgtgggctggactacgatgcctacaatagctccagcaacaccacctgtgtcaac
tggaatcaatactacaccaactgctccgcgggggagcacaaccccttcaagggcgccatc
aactttgacaacatcggctatgcctggattgccatcttccaggtcatcacgctggagggc
tgggtggacatcatgtactttgtgatggatgctcattccttctacaacttcatctacttc
atcctcctcattatcgtgggctctttcttcatgatcaacctgtgcctggtggtgattgcc
acgcagttctcagagaccaagcagcgggaaagccagctaatgcgggagcagcgggtgcgc
ttcctgtccaacgccagcaccctggccagcttctcggagccaggcagctgctacgaggag
ctactcaagtacctggtgtacatcctccgaaaagccgcccgcaggctggcccaggtctcc
cgggcagtgggtgtgcgggtggggctgctaaacagcccagtggcccatgggggccaggag
tccctgcccagcggcagctgctctcgctcgcaccgccgcccgtctgtccaccaccttgtg
catcatcaccaccaccatcaccatcactaccacctgggcaacgggacgctgagggctccc
cggtccagcccggagatccaagacagggaagccaatgcatcccgccggctcatgctgcca
ccgccctcaacacctgccctctctgcgggccctccggggggcacagagtctgtgcacagc
ttctaccatgccgactgccacctggagccagtccgctgccaggcgccccctcccaggtca
ccatctgaggcatcgggcaggactgtgggcagcgggaaggtgtaccccactgtgcaaacc
agctctccaccagagctgctgaaggagaaggcgcttgttgaggtggctcctgcctccagg
ccccctaccctcaccagcctcaacatcccacctgggccttacagctccatgcacaagctg
ctagagacacagagcacgggtgcctgccaaagctcttgcaagatctccagcccttgcttg
aaggcagacagaggagcctgtggcccagacagctgcccgtactgtgcccgggtggggcca
ggggaggcggagctcgctgaccatgaggtacccgactcagacagcgaggcggtttatgag
ttcacacaggacacccagcacggtgacctccgggacccccacagccagcggcgacggagc
ctggggcccaatgcagagcccagctctgtgctggccttctggaggctaatctgtgacact
ttccagaagattgtggacagcaagtactttggtaggggaatcatgatcgctatcctggtc
aacacgctcagcatgggcatcgaataccacgagcagcctgaggagctcaccaacgcactg
gaaatcagcaacatcgtcttcaccagcctctttgccctggagatgctgctgaagctgctt
gtgtacgggccctttggctacatcaagaatccctacaacatctttgatggcgtcatcgtt
gtcatcagtgtctgggagatcgtaggccagcaggggggtggcctgtcggtgctgcggacc
ttccgcctgatgcgggtgctgaagctggtgcggttcctgccggcgctgcagcggcagctc
gtggtgctcatgaagaccatggacaacgtggccaccttctgcatgctactcatgctcttc
atcttcatcttcagcatcctgggcatgcatctcttcggctgtaaattcgcgtctgagagg
gatggggacacgctgccagaccggaagaattttgactccctgctctgggccatcgtgaca
gtcttccagatcctgacccaggaggactggaacaaggtcctttacaacggaatggcctcc
acgtcgtcctgggctgccctttacttcatcgccctcatgacctttggcaactatgtgctc
tttaacctgctcgtcgccattctagtggagggcttccaggcggaggaaatcagcaaacgg
gaagatgcgagtggacagttgagctgtattcagctgcctgtcgactcccaggggggagat
gccacaaagtctgagtcggagcctgatttcttctcgccaagcctcgaaggcaatggggac
aggaagaagtgcttggccctggcatccctgggagagcacccggagctgcggaggagcttg
ttgccgcctctcatcatccacacggctgccacgcccacgtcactgcccaaaagctccagc
actggcctggcggagcccctgggccctgcctcccgccgcaccagcagtagctggtccgca
gagcctggggtggcccaggagatgaagtcaccgccgagtgcccgtagctccccacacagc
ccctggagcgcagcaagcagctggaccagtaggcgctctagccgaaacagccttggtcgt
gccccaagcctgaagcggaggagtccgagtggggagaggcggtccctattgtctggtgaa
ggccgggagagccaggatgaggaggacagctcagaagaggagagggctaccccagcgggc
agtaaccgtcgccatagggagtcactggagcgggaagccaagggctctttcgacctgcca
gataccctgcaggtgcctgggctgcaccgcacagccagcggccgaagctcagcctcagag
caccaggactgcaatggcaagtcagccccagggtgcctggcccgggtcctgcatcccgat
gaccccccactggatggggacgatgctgatgatgagggcaacctgagcaaaggggaacga
atgagggcatggatccgagcccggctccctgcctgctgtcaagagcgagactcttggtcg
gcctacatcttccctcctcagtcaaagttccgcctcctgtgtcaccggatcatcactcac
aagatgttcgaccatgtggtcctcatcatcatcttcctcaactgtatcaccatcgccatg
gagcgcccccaaatcgacccccacagcgctgaacgcatctttctgactctctccaattat
atcttcaccgcagtctttctggctgaaatgacagtgaaggtggtggctctgggctggtgc
ttcggggagcaggcatacctgcgcagcagctggaacgtgctggacgggctgctggtgctc
atctccatcattgacatcctggtgtccctggtctccgacagcggcaccaagatcctgggc
atgctgagggtgctgcggctgctgcggaccctgcgcccgctcagggtaatcagccgggca
caggggctgaagctggtggtagagacgctgatgtcctcactgaagcccatcggcaacatc
gtggtcatctgttgtgccttcttcatcatttttggcatcctgggggtgcagctcttcaaa
gggaagttctttgtgtgccagggtgaggataccaggaacatcaccaacaagtctgactgt
gctgaggccagttaccggtgggttcggcacaagtacaactttgacaacctcggccaggcc
ctgatgtctctgttcgttctggcctccaaggacggctgggtggacatcatgtatgatggg
ctggatgctgtgggtgtggaccagcagcccgtcatgaaccacaacccctggatgctgctc
tacttcatctcgttcctgctcatcgtggccttctttgtcctgaacatgtttgtgggtgtg
gtggtggagaacttccacaaatgtcggcagcaccaagaggaggaggaggcccggcggagg
gaggagaaacgactgcggagactggagaaaaagagaaggaatctaatgctggacgatgta
attgcttccggcagctcagcctgcgcggcgccagaagcccagtgcaaaccctattactca
gactactcccgtttccggcttctcgtccatcacttgtgcaccagccactacctggatctc
tttatcacgggtgtcattgggctgaatgtggtcaccatggccatggagcactaccagcag
ccccagatcctggatgaggctctgaagatctgcaactacgtcttcaccatcatcttcgtc
ttggagtcagtcttcaaacttgtggcctttggcttccgtcggttcttccaggataggtgg
aaccaactggacctggccattgtgctgctgtccatcatgggcatcacactggaggagatc
gaggtcaatgcctcactgcccatcaaccccaccatcattcgcatcatgagggtactgcgt
attgcccgagtgctgaagctgctgaagatggcggtgggcatgcgggcgctgctggacaca
gtgatgcaggcccttccccaggtggggaacctgggacttctcttcatgttgttgtttttc
atctttgcagctctgggtgtggagctctttggagacctagagtgtgatgagacgcacccc
tgtgagggcctgggccggcatgccacctttcggaactttggcatggccttcctgaccctc
ttccgagtctccactggtgacaactggaacggcattatgaaggacaccctccgggactgc
gaccaggagtccacctgctacaacaccgtcatctctcccatctacttcgtgtccttcgtg
ctgacagcccagtttgtgctggtcaatgtggtgatcgctgtgctgatgaagcatctggag
gagagcaacaaggaggccaaggaggaggccgagctggaggccgagctggagctggagatg
aagaccctcagcccacagccccactcaccactgggcagccccttcctctggcctggggtc
gagggccctgacagccctgacagccccaaccctggggccctgcaccctgcagcccacgcc
agggcagcctcacggttctccttcgagcaccccacggacagacaactgtttgacaccata
tccctgctgatccagggctccctggagggggagctgaagctgatggacgagctggccagc
ccggggggccagccttctgccttccctcccgcccctagcccgggcggctccgacccacag
atccctctagctgagatggaggctctgtctctgacgtcagagattgtatctgaaccgtcc
tgctctctagctctgacggatgactctttgcctgatgacactcacatactcttacttagt
gccctggagagcaatatgcagccccaccctgaggaggtgcccgtcaccctgggactggac
ctgctgactgtccgcaagtctggggtcagccgcacgcactctctgcccaatgacagctac
atgtgccgggatgggagtgctgctgaggggtccccgggacacaggggccgggggctcccc
aaagctcagtcaggctctgtcttgtccattcactcccagccagcagacaccagctacatc
ctgaagcttcccaaagatgcaccccacctgctccagccccacagcactcccacctggggc
accatccccaaacttcccccaccaggccgttcccctttggctcagaggccactccggcgc
caggcagcaataaggactgattccctggacgtgcagggtctgggcagcagggaagacctg
ctatcagaggtgagtgggccctccccgcctctggcccgggccacctctttctggggccag
acaagcatccaggtacagcagcacgcccgaagccagagcaagatcttgaagcacatgccc
cctccagccccacgcccaggcccagagcccatttgggccaagggcccacccgagaccagc
agcagcttagagctggacacggagctgagctggatttcaggggacctcctgacggtcagc
agccaggaggagtccccatccccacgggacctgaagaaatgctacagcgtggaggcccag
agctgccggcgccggcccgcgtcctggctggatgaacagaggagacattccatcgcagtc
agctgtctggacagtggctcccagccccacctgagccctggcccctctagccttggggcc
cagactcttggggggcctgggagccggcctaagaaaaaactcagcccacccagtatttcc
atagaccctccggagagtcagggccctcggcccccacccagccctggtgtctgtctccgg
cgaagggctccatctagtgactccaaggatccctcggcctcaggcccccctgacagcatg
gctgcctcgccccctccaaagaaagatgtgctgagtctctctggtttatcctctgaccca
acagacccggacccctga

KEGG   Loxodonta africana (African savanna elephant): 100675598
Entry
100675598         CDS       T04351                                 

Gene name
CACNA1H
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1H
  KO
K04855  voltage-dependent calcium channel T type alpha-1H
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04713  Circadian entrainment
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675598 (CACNA1H)
   04020 Calcium signaling pathway
    100675598 (CACNA1H)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100675598 (CACNA1H)
   04925 Aldosterone synthesis and secretion
    100675598 (CACNA1H)
   04927 Cortisol synthesis and secretion
    100675598 (CACNA1H)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100675598 (CACNA1H)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100675598 (CACNA1H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100675598 (CACNA1H)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100675598 (CACNA1H)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 100675598
NCBI-ProteinID: XP_023413079
LinkDB
Position
Unknown
AA seq 1969 aa
MEGPLFSTTFIYFILLIIVGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDST
LASFSEPGSCYEELLKYVGHVVRKVQRRGLRLYAHWQSRWRKRVGSDATLPGQGPGRRQS
RAGRRMASIHHLVYHHHHHHHHYHFSHGSPRRPGDRNCKLVRTSAPASTPAPGPAPPDAV
HSVYHANCRVEGPQERVRAVHTTATGLKLASGLGIMNYPTILPSGTHGKGSASPGSEGPP
GTGVHSPTGLSSPDPYEKIQHLVGEHGLGRTPSRLSGLSVPCLLPSPQAGTLACELKSCP
YCASALDDPELEVSGSESSDSDSNGIYEFTQDVQCGDRRDPLQPPAAETPSQGGRPRQWA
REQAAGEPGGPGRIWAAFNGKLQRIVDSKYFNRGIMVAILVNTLSMGVEYHEQPDELTSA
LEISNVVFTSLFALEMLLKLLACGLLCYIRNPYNIFDGVIVVISVWEIIGQADGGLSVLR
TFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLK
TDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNY
VLFNLLVAILVEGFQAEGDASRSDTDEDKTSAHLEEDLDKLRNLPATEMKICSLAMTPNG
HLEGRGSLPPPLIMHTAATPMPTPKGSPHLDSAPGLLESRRGSSGSMDPQLGXRKPPSSP
RSSPCAPWGSNSTWSSRRSSWNSLGCAPSLKRRSQCGERESLLSGEGRGSTDDXVEDGRL
STGGCPRGARPPHCGHTESLDHHSTLDLRPPQPITLLPAKFQDWNGQTVALPSEFFLRID
SHKEDLADLEDDMEDSCCFRLCAVLGRYKPQWCRHHEPWALYVFSPQNWFRVVCQKVIAH
KMFDHVVLVFIFLNCITIALERPDIDPGSTERVFLSVSNYIFTAIFVAEMMVKVVALGLV
SGEHAYLQSSWNVLDGLLVLVSLVDIVVAVASAGGAKILGVLRVLRLLRTLRPLRVISRA
PGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFHYCEGADTRNISTKAEC
HAAHYRWVRRKYNFDNLGQALMALFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLL
YFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREAKRLRHLERRRRSTFPSPE
AQRRPYYAEYSPTRQAIHSLCTSHYLDLFITFIIGVNVITMSMEHYDQPKSLDEALKYCN
YVFTIVFIVEAMLKLVAFGFRRFFKDRWNQLDLAIVLLSIMGITLEEIEMNAALPINPTI
IRIMRVLRIARVLKLLKMAVGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGR
LDCSEDNPCEGLSRHATFTNFGMAFLTLFRVSTGDNWNGIMKDTLRECVREDKHCLSYLP
VISPIYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAELDTELELEMARVPPAAAT
TTPEAPSLLVVRKVSVSRMLSLPNDSYMFRPVAPAAPQMLQEMEMETYTGVAASGVEASI
VEASGAVPPASSPGASRATLQVPPETMRIPTPSTPSPVRSSNTLQAPSPQAAPCSPGLSQ
LLCRQEPVRMDSLEGQMDGSQDSASGPGELGEKAAGRPVPLGAPLWTPPRSPRPFSSPRP
SSVLTLRHTFGQRCVASRAPGADEAADPADEEVRYITSVVQPWLPEPEPHSPQASPTASP
AVLGGLYHLCSADGWNCRAGPGWADGQRQLVMEPGGDSSRDEAPEAEPALGTRRKKKMSP
PCISIDPPAEDEGASRAPASEGGSTTLRRRTPSCEAPLGPAAPHRDPLEPMEGPGAGVDP
SGKGERWGQAPAWAEHLTVPNFAFEPLDAGPPSGDSVLDSGQDVAPEPHASSLGAMMPLE
PHNIEPPVPSIDPPEKGQGVLLTAPESSPKKLGSLPATPAPDDSIEDPV
NT seq 5910 nt   +upstreamnt  +downstreamnt
atggaaggcccactcttttctacaactttcatctacttcatcctgctcatcatcgtgggc
tcctttttcatgatcaacctatgtctggtggtgatcgccacacagttttcggagaccaag
cagcgggaaaaccagcttatgcgtgagcagcgagcccgctacctgtccaatgacagcacc
ctggccagcttctctgaaccaggcagctgctacgaagagttgctcaagtacgtgggccat
gtggtacgcaaggtacagcggcgcggcctgcgcctctacgcccactggcagagccgctgg
cgcaagcgggtgggctcagatgccacgctccccggccagggacccgggcggcggcagagc
cgggcaggccggcgcatggcctccatccaccacctggtctaccaccaccaccatcaccac
caccactaccacttcagccacggcagcccgcgccggccaggcgaccgaaactgtaagctg
gtgcgtaccagcgccccagcctcgacccccgcccctggccctgcaccccccgatgccgtg
cacagtgtctatcatgccaactgccgtgtggaggggccacaggagcgtgtccgggcagtc
cacaccaccgccactggcctcaagctggcctcaggtctgggcatcatgaactaccccacc
atcctgccctcaggaacgcatggcaagggcagcgccagccctgggtctgaggggccgcca
ggcactggggtgcacagccccacgggcctgagcagccccgacccctacgagaagatccag
cacttggtcggggagcatggactgggccgaacccccagccgcctgtcgggcctgagtgtg
ccctgcctgctgcccagcccccaggcaggcacgctagcctgtgagcttaagagctgcccc
tactgtgccagtgccctggacgaccctgagctcgaggtcagtggctccgagagcagtgac
tcagacagcaacggcatctatgagttcacgcaggatgtgcagtgcggtgaccgccgtgac
cccctgcagccacctgctgctgagacacccagccaaggtggtagacctcggcagtgggca
cgtgagcaggcggcgggtgagccgggtgggccaggccgcatctgggccgccttcaacggc
aagctgcagcgcattgtggacagcaagtacttcaaccgtggcatcatggtggccatcctg
gtcaacacactgagcatgggtgtcgagtaccacgagcagcctgacgagctgaccagtgcc
ctggagatcagcaacgtcgtcttcaccagcctctttgctttggagatgctgctgaagctg
ctggcctgcgggctgctgtgctacatccgcaacccatacaacatcttcgatggtgtcatt
gtggtcatcagcgtctgggaaatcattgggcaggcagacggtggcctgtcagtgctgcgg
accttccggctgctgcgggtgctgaagctggtgcgcttcatgcccgcactacggcgccag
ctggtggtgctcatgaagaccatggacaatgtggccaccttctgcatgctgctcatgctc
ttcatcttcatcttcagcatcctgggcatgcatctttttggctgtaagttcagtctgaaa
acagacacaggagacaccgtccccgacagaaagaatttcgactccctgctgtgggccatc
gtcaccgtgttccagatcctcactcaagaggactggaacgtcgtcctctacaatggcatg
gcctccacctcctcctgggctgccctctactttgtggctctgatgacctttggcaactac
gtgctcttcaacctgctggtggccatcctggtggagggcttccaggcagagggtgatgcc
agcaggtctgacacggatgaagacaagacatcagcacacttggaggaggacttggacaag
ctcaggaacctgccggccacagagatgaagatatgctccctggcaatgacccccaacggg
cacctggagggccggggcagcctgccccctcccctcatcatgcacacagcggccactccc
atgcccacccccaaggggtccccccacctggactcagcccctgggctgctggaatctcgg
cgtggcagcagcggctccatggatccccagctgggnnccaggaagcctccttccagcccc
cgcagctcgccctgcgccccctggggctccaacagcacctggagcagccggcgctcaagt
tggaacagcctgggctgtgcgcccagcctcaagcgtcggagtcagtgtggagagcgcgag
tcgctgctgtcgggcgagggtaggggcagcacagacgactaggtcgaggatggcaggctc
agcacagggggctgccccaggggtgcgcgaccaccccactgcgggcacactgagtctctg
gaccaccacagcacactggacctgaggcccccgcagccgatcacccttctgcctgccaag
ttccaagactggaatgggcagacagtggccctgcccagcgagttcttcctgcgtatcgac
agccacaaggaggacctggccgacctggaagacgacatggaagacagttgctgcttccgc
ctctgcgcagtgctgggccgctacaagccccagtggtgccgccaccacgagccctgggca
ctttatgtcttctcgccacagaactggttccgagttgtctgccagaaagtcatcgcccac
aagatgtttgaccatgtggtgctggtcttcatcttcctcaactgcatcaccatcgcgctt
gagcggcccgacatcgatccaggcagcactgagcgtgtcttcctcagcgtctccaactac
atcttcacagcgatcttcgtggcggagatgatggtgaaggtggtggccctgggcctggtc
tcaggcgagcatgcctacctgcaaagcagctggaatgtgctggacgggctgctggtcctg
gtgtccctggttgacatcgtggtggccgtggcctcagctggcggtgccaagatcctgggt
gtgcttcgggtgctgcggctgctgaggacactgcgacccctcagggtcatcagccgtgcg
ccaggcctcaagctggtggtggagacgctcatctcctcgctcaggcctataggaaacatt
gttctcatctgctgtgccttcttcatcatctttggcatcctgggcgtgcagctcttcaag
ggcaagttccactactgcgagggtgccgataccaggaacatctccaccaaggccgagtgc
catgctgcacactaccgctgggtgcggcgcaagtacaacttcgacaacctgggccaggcc
ctgatggccctgtttgtgctctcgtccaaggacggctgggtgaacatcatgtatgatggg
ctggacgccgtgggcattgaccaacagcccgtgcagaaccacaatccctggatgttgctg
tacttcatctccttcctgctcatcgtcagcttcttcgtgctcaacatgtttgtgggcgtc
gtggtggagaacttccacaagtgccggcagcaccaggaggctgaggaggcacggcggcgc
gaggcgaagcggctgcggcacctggagcggaggcgaaggagcacatttcccagcccagag
gcccagcgccggccctactacgccgagtattcacccacccgccaagccatccattcgctc
tgcaccagccactacctcgacctgttcatcaccttcatcatcggggtcaacgtcatcacc
atgtccatggagcactacgaccagcccaagtcactggacgaggccctcaagtactgcaac
tatgtgttcaccatcgtcttcatagtcgaggccatgctgaagctggtggcatttgggttt
cggcggtttttcaaggacaggtggaatcagctggacctggccattgtgctgctgtccatc
atgggcatcacgctggaggagatcgagatgaacgcggcactgcccatcaaccccaccatc
attcgcatcatgcgcgtgctccgcatcgcccgggtgttgaagctgctcaagatggccgtg
ggcatgcgggcactgctggacacagtggttcaagccctgccccaggtagggaaccttggc
ctacttttcatgctcctgttttttatctatgctgccctgggagtggagctgtttgggagg
ctagactgcagcgaggacaacccctgcgagggtctgagcagacacgcaaccttcaccaac
ttcggcatggccttcctcacgctattccgcgtgtccaccggtgacaactggaatgggatc
atgaaggacacgctccgtgagtgtgtgcgtgaggacaagcactgtctcagctacctgccg
gtcatctcacccatctacttcgtcaccttcgtgctcgttgcccagttcgtgctggtcaat
gtggtggtggccgtgctcatgaagcatctggaggaaagcaacaaggaggcacgtgaggac
gctgagctggacaccgagctggagctggagatggcccgagtcccacctgccgctgccacc
accacgccagaggccccaagcttgctggtggtgcgcaaggtgtctgtgtcccgcatgctc
tcgctgcccaatgacagctacatgttccggcctgtggcgcccgcggccccgcagatgctg
caggagatggagatggagacatacacaggcgtggcggcctcgggtgtggaagcctcaatt
gtggaagcctcaggcgctgttccccctgccagctcgcccggggcgtcccgtgccactctc
caggtcccacctgagacgatgcgtataccaaccccatccactccttccccggtgaggtcc
agcaacaccctgcaggccccctccccgcaggctgcaccctgctcccctggccttagccaa
ctgctctgcagacaggagcccgttcgcatggactccctggaaggacagatggacggctcc
caggacagcgcctcgggaccgggcgagcttggggagaaggctgcaggccggccggtgcca
ctgggggctcctctgtggaccccgccccgctccccgaggcctttcagctccccaaggccc
tccagtgtgctcaccctcaggcacacgttcggacagcgctgcgtggccagccgggcacca
ggcgctgatgaggctgcagacccggctgatgaagaggtgcggtacatcaccagcgtggtg
cagccctggctgcctgagccggagccccacagtccccaggcctcccccactgcctcccca
gccgtcctagggggcctgtaccacctctgcagcgctgatggctggaactgccgggcaggg
cctggctgggcagatggccagaggcagctggtcatggagccaggcggggacagcagtcga
gatgaggcccccgaggctgagccagcactgggcacgcgccgcaagaagaagatgagtccc
ccctgcatctctatcgacccccctgcagaggatgagggtgccagccgagcccctgcatct
gagggcggcagcactaccctgcggcggagaaccccatcctgtgaggcccccctgggccca
gccgccccccacagggacccactggagcctatggagggcccgggggctggggtcgacccc
tccggtaagggagagcggtggggccaggccccagcctgggcagagcacctgactgtcccg
aactttgcctttgagccactggatgcagggccccccagtggggactccgttttggacagt
ggtcaggatgtagccccagaacctcacgcttcctccttgggggccatgatgcctctggaa
ccccacaatatagagcctcctgtgccctccattgaccccccagagaaggggcagggggtg
ctcctcacagctcccgagagctccccaaagaaactagggtccctcccagccacccctgcc
ccagatgacagcatagaggatcctgtgtag

DBGET integrated database retrieval system