KEGG   Loxodonta africana (African savanna elephant): 100660353
Entry
100660353         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 1-like
  KO
K17445  insulin receptor substrate 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04068  FoxO signaling pathway
lav04140  Autophagy - animal
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04930  Type II diabetes mellitus
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100660353
   04022 cGMP-PKG signaling pathway
    100660353
   04152 AMPK signaling pathway
    100660353
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100660353
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660353
   04923 Regulation of lipolysis in adipocytes
    100660353
   04920 Adipocytokine signaling pathway
    100660353
   04935 Growth hormone synthesis, secretion and action
    100660353
  09149 Aging
   04211 Longevity regulating pathway
    100660353
   04213 Longevity regulating pathway - multiple species
    100660353
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660353
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100660353
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   100660353
SSDB
Motif
Pfam: PH
Other DBs
NCBI-GeneID: 100660353
NCBI-ProteinID: XP_023397511
LinkDB
Position
Unknown
AA seq 537 aa
MKLGGGVPTATPESKSADVPLGPPLPWPCPADVRLCGHLRKQKSHRRRFFVLRVDPPRLE
CYGSEQKFRASCGKSARPKLSVSLEGACTISKRADVRQRHLIFLYTRDSSLGVAAASEAE
QQAWYTALLEVRAATAAAGEARAWAGGKGLPGTGGSIWVLAPSEDPFQDVLAVTLRXQGL
GRTRGLSSGSYRLCLGSGTLSLLRKPRAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLQAPDAVVAQSIHETVLASMKRLAGGGAGGRVDPMPRGPPTCASR
PSVPQLYETQASAAQSGGLSRRRCLGERSEQTTLKTLTRLGPAASYPQGLERGRGYITVG
ARSDYEPMGGGEASGYVVMAPPRNHPGPPPAANAAPRSSSSTSLPRSYKPGTVEPGLELQ
STHHGVGGSLGLAGAQPRSKPLSELAGEYVRIGYGAPDYVAMGTARPKPSDGRLNYVDLD
LVPPQEEGGDAPATGTDRPHSYARTAFQKLWEASVRRPRGSRVSFSGDRRETAQSYG
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgaagctcggaggtggcgtccccacggcgaccccagagtccaagtccgccgacgtgccc
ctcggcccgccgctgccctggccctgcccggctgacgtgcggctctgcggccaccttagg
aagcagaagtcccatcgccgccgcttcttcgtgctccgcgtcgacccgccgcgcctcgag
tgttacgggagcgagcagaagttccgcgccagctgcggcaagtcagcgcggcccaagctc
agcgtgagcttggagggcgcgtgcaccatcagcaagcgcgcggacgtgcgccagcgccac
ctgatcttcctctacacgcgcgacagcagcctgggcgtggcagcggccagcgaggcggag
cagcaggcgtggtacaccgccctgctcgaggtgcgcgccgccaccgccgccgccggtgag
gcccgagcctgggcgggtggaaaagggctgccagggacgggagggagcatttgggtccta
gctccttccgaagatccgtttcaggacgttctggccgtgacgctgcgtnnacaagggctg
gggcggacacgaggcctgagcagcggctcctaccgcctatgtctgggttcggggacactg
agcctgctgcggaaaccgagggcagaannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnggctgcaggcacccgac
gctgtggtggcccaaagcattcatgagaccgtcctagcctccatgaagcgactcgcgggc
ggtggtgcaggcggcagggttgacccaatgccgaggggacccccgacgtgcgcctccaga
ccctctgttccccaactttatgagacccaggcctccgcggcccaatcaggcggcttgagc
cgtcggcggtgtttgggtgagaggagcgagcaaaccaccctgaagaccctgaccaggctg
gggccggcagcctcgtacccccaggggttggagcggggcagaggctacataaccgtggga
gcccggagtgactatgagcccatggggggcggcgaagccagcggctacgtggtgatggcg
cccccgcgcaatcacccgggccctccgcctgctgccaacgctgctcctcggtcctcttcc
tcgacctccctgccccgttcctacaagcccgggaccgtggaacctggacttgagctccag
agcacccatcatggcgtcggaggcagcctgggactggcgggcgctcagccccgctcgaag
ccgctgtccgagctcgccggggagtacgtgcgcatcgggtacggggcccccgactacgtg
gcaatgggcactgccaggccgaagccctccgacggccgcctcaactacgtggacctcgac
ctggtcccgcctcaggaggagggcggcgacgcccctgcgaccggcaccgaccgcccgcac
agctacgcgcgcactgcgttccagaagctctgggaagcgtcggtgaggaggccccgcggc
agcagagtctcgttttccggggacaggagggaaactgcacaaagctacgggtga

KEGG   Loxodonta africana (African savanna elephant): 100664968
Entry
100664968         CDS       T04351                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04068  FoxO signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav05010  Alzheimer disease
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100664968 (IRS1)
   04022 cGMP-PKG signaling pathway
    100664968 (IRS1)
   04151 PI3K-Akt signaling pathway
    100664968 (IRS1)
   04152 AMPK signaling pathway
    100664968 (IRS1)
   04150 mTOR signaling pathway
    100664968 (IRS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100664968 (IRS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100664968 (IRS1)
   04923 Regulation of lipolysis in adipocytes
    100664968 (IRS1)
   04920 Adipocytokine signaling pathway
    100664968 (IRS1)
   04935 Growth hormone synthesis, secretion and action
    100664968 (IRS1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100664968 (IRS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100664968 (IRS1)
  09149 Aging
   04211 Longevity regulating pathway
    100664968 (IRS1)
   04213 Longevity regulating pathway - multiple species
    100664968 (IRS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100664968 (IRS1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664968 (IRS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100664968 (IRS1)
   04932 Non-alcoholic fatty liver disease
    100664968 (IRS1)
   04931 Insulin resistance
    100664968 (IRS1)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   100664968 (IRS1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 100664968
NCBI-ProteinID: XP_003417936
LinkDB
Position
Unknown
AA seq 1114 aa
MASPPETDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAAPGLGGGGGSCSGSACLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPTSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPGEEELSNYICMGGKGASTLTAPNGHY
ILARGGNGHRYIAGASLGTSPALIADEAASAADVDSRFRKRTHSAGTSPTISHQKTPSQS
SVASIEEYTEMMPAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHPLERRGGHQRPDT
STLHTDDGYMPMSPGVAPVPSTRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYM
MMSPSGSCSPDIGGGPSSSSTAPSGSSYGKLWTNGVTGHHSHPLPHPKPPVESSGGKLLP
CTGDYMNMSPVGDSNTSSPSDCYYGPQDPQHKPVLSYYSLPRSFKHTQRPGEPEESGRHQ
HLRLSSSSGRLLYAAAAEDSFLPSTSSDRPGRGILVGLGPGAWGTRNSSTNPVVMGRVDP
APPGAVSVCRPTRAVPSSRADYMTMQMGCSRQSYVDTSPVAPVSYADMRTGIAAEDVSLP
GATAAAPSSSPAASASSTAPQGAAELAARPSLLGGPQGPGGMSAFTRVSLSPNRNQSAKV
IRADPQGCRRRHSSETFSSTPSATRAGNAVPFGGGAGAGGSSGASSSEDVKRHSSASFEN
VWLRPGELGGAPKEPAQVCGAAGGFENGLNYIDLDLVKDFKQRPQEHPPQPQPPPPPPPH
QPLGSSDSSSPSRSSEDLSAYASISFQKHPEDLQ
NT seq 3345 nt   +upstreamnt  +downstreamnt
atggcgagccctccggagaccgacggcttctcggacgtgcgcaaggtgggctacctgcgg
aaacccaagagcatgcacaagcgcttcttcgtgctgcgggcggccagcgaggctgggggc
ccggcgcgcctggagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcaattcccctggagagctgcttcaacatcaacaagcgagcggactccaagaac
aagcacctggtggctctctacacccgggacgaacactttgctatagcggcggacagcgag
gccgagcaggacagctggtaccaggccctgctgcagctgcacaatcgtgcgaaggggcac
cacgatggggctgcggcgcccgggctgggcggcggcgggggcagctgcagcggcagcgcc
tgcctcggtgaggctggggaggacttgagctatggggacgttcccccaggccctgccttc
aaggaggtctggcaggtgatcctgaagcccaagggcctggggcagacaaagaacctgatt
ggcatctaccgtctctgcctgaccagcaagaccatcagcttcgtgaagctcaactcagaa
gcggctgccgtggtgctgcagctgatgaatatcaggcgctgcggccactccgagaacttc
ttcttcatcgaggtgggccgctcggccgtaacagggcctggggagttctggatgcaggtg
gatgactcggtggtggcacagaacatgcacgagaccatcctggaggccatgcgagccatg
agcgatgagttccgacctcgcagcaagagccagtcctcctccaactgctccaaccccatc
agtgtccccctgcgcaggcaccaccttaacaacccccctcccagccaggtggggctgact
cgccgctcgcgcaccgagagcatcaccgccacctcccctgccagcatggtgggcgggaag
cccggctccttccgggttcgcgcctccagtgatggcgaaggcaccatgtcccgcccagcc
tcagtggacggcagccctgtgagtcctagcaccaacaggacccatgcccaccggcatcgc
ggcagcgcccggctgcaccctccgctcaaccacagccgctccatccccatgcctacttct
cgctgttcgccttccgccaccagcccggtcagcctatcgtccagcagcaccagtggccac
ggctccacctctgactgcctctttccacggcggtctagtgcttctgtgtccggttccccc
agcgatggtggcttcatttcctccgatgagtatggctccagtccttgcgatttccgaagt
tccttccgaagtgtcaccccagattccctgggccacacccccggagaggaggagctgagc
aactatatctgcatgggcggcaaaggggcctccaccctgactgcccccaatgggcactac
atcttggctcggggtggcaatggccaccgctacatcgcaggagctagcttgggcacgagc
ccagcgctgattgcagatgaagcagccagtgctgcagatgtggatagtcgcttccgaaag
aggactcactccgcaggcacgtcccccaccatttcccaccagaagaccccatcccagtcc
tccgtggcgtccatcgaggagtatacagagatgatgcccgcctacccaccaggagggggc
agtggaggccgactgcccgggtaccggcactctgccttcgtgcccacgcactcctacccg
gaggagggtctggaaatgcatcccttggagcggcgtgggggccaccaacgcccagacacc
tccaccctccataccgatgatggctacatgcccatgtccccaggggtggcaccagtgccc
agcacccgaaagggcagtggggactacatgcccatgagtcccaagagcgtgtctgcccca
cagcagatcatcaaccccatcagacgccatccccagagagtggaccccaatggctacatg
atgatgtctccaagtggcagctgctcccctgacattggaggtgggcccagcagcagcagc
accgccccttctgggagcagttatggaaagctgtggacaaatggggtaacgggccaccat
tctcaccccttgcctcaccccaaaccacctgtggagagcagtggtggcaagctcttgcct
tgcaccggtgactatatgaacatgtcacccgtgggggactccaacaccagcagcccctcc
gactgctactacggcccccaggaccctcagcacaagccggtcctctcctattactcattg
ccaaggtcctttaagcacacccagcgcccaggggagccagaggagagtggccggcaccag
cacctccggctttcctccagctctggccgtcttctctatgctgcagcggcagaagattct
ttccttccgtccaccagcagtgacaggcctgggagggggatactggtgggtctcgggccg
ggagcctggggcacccgcaattcttccaccaatccagtggtgatgggcagagtggaccct
gcacctcccggggctgtgagtgtgtgcaggcccaccagggctgtgcccagcagccgggct
gactacatgaccatgcagatgggctgttcccggcagagctatgtggacacctccccggtc
gcccctgtcagctatgccgacatgcggaccggtattgctgcagaggatgtgagccttcct
ggggccacagcggctgctccttcctcatccccagcagcctctgcctcgtctactgcacct
caaggagcagctgagctggctgcccgcccttccttgctggggggcccacagggacctggg
ggcatgagcgccttcacccgggtgagcctcagccccaatcgcaaccagagtgccaaagtt
atccgtgcggacccgcaagggtgccggaggaggcatagctccgagaccttctcctcaaca
cccagtgccacccgggcaggcaatgccgtgccctttggagggggggctggggcagggggc
agcagcggtgccagcagcagtgaggatgtgaaacgccacagttctgcttcctttgagaac
gtgtggctgaggcctggggagctcgggggagcccccaaggagccagcccaggtgtgtggg
gctgctgggggcttcgagaatggtcttaactacatagacctggatttggtcaaggacttt
aaacagcgccctcaggagcatccccctcaaccgcagccccctccaccaccaccccctcat
cagccccttggtagcagtgatagcagctcgcccagccgctccagcgaggatttaagcgcc
tatgccagcatcagtttccagaagcatccagaggacctccagtag

KEGG   Loxodonta africana (African savanna elephant): 100667324
Entry
100667324         CDS       T04351                                 

Gene name
IRS4
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04068  FoxO signaling pathway
lav04140  Autophagy - animal
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04930  Type II diabetes mellitus
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100667324 (IRS4)
   04022 cGMP-PKG signaling pathway
    100667324 (IRS4)
   04152 AMPK signaling pathway
    100667324 (IRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100667324 (IRS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100667324 (IRS4)
   04923 Regulation of lipolysis in adipocytes
    100667324 (IRS4)
   04920 Adipocytokine signaling pathway
    100667324 (IRS4)
   04935 Growth hormone synthesis, secretion and action
    100667324 (IRS4)
  09149 Aging
   04211 Longevity regulating pathway
    100667324 (IRS4)
   04213 Longevity regulating pathway - multiple species
    100667324 (IRS4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100667324 (IRS4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100667324 (IRS4)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   100667324 (IRS4)
SSDB
Motif
Pfam: IRS PH_11 PH_8 PH
Other DBs
NCBI-GeneID: 100667324
NCBI-ProteinID: XP_023409590
LinkDB
Position
Unknown
AA seq 1287 aa
MASCSFVRDQATSSLRAAVAAAAAAPPAAATTSLLSSETPTALIGTGXSCPGAMWLSAAT
GSRSDSESEEEDLPVGTKFCKRGYLRKQKHGHRRYFVLKLETAERPARLEYYENARKFRH
SVRAAAAAAAAAASGAAVPALIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWCVLLSRLILQSKRRRCGTPGAEPDQEGSALAVAAAAAEPPFYKDVWQVVI
KPKGLGHRKELSGVFRLCLTDEEVLFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRS
TVIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSIGTHLLTLLSARRHL
DSLPFQPGGWLRRSRFELCHLSAIGDGEDEMFLTRRFISAREPVPHFRRGRQHLPRMRRP
RRAMSVPASCFRHLPRKLMVVPAEAPNDGACLSSEASGSGNSGEEGNPQGNESQEGNGGD
YMPMNNWGSGNGRGTGGGQGSSGQGSSSQSSGGNQCSGGGQGSGGGQSSSHGQGSGGQGA
GGNQCSGNGQGTAGGHGSGSGQGAGGGHGSGGGQGPGGGHGSGGGGKDSGGGKGSRSGKG
SDGNDERGKSLKKRSYFSKLTQSKQQQMLPPPPPPPPPPSPPPPPPPPPPPPPPPPPTPG
ATGGKGKSGGRFRLYFCADRGATKERKEPKDVKEAETSEGAARYPHRARAFDEDEDDPYV
PMRPGVAAPLASSSDYMPMAPQNVSASKKRHSRSPFEDSRGYMMMFPRASPPPAPTPPKE
PEPNKEDDSKDNDSDSDYMFMAPGAGAIPKNPRSPQGGSSSKSWSSYFSLPDPFQSSPLG
QNDHSEYVPMLPGKFLGRGPDKEASFNRGPKDAPSKPLDQGFCPEPGDGGSPSKPSDDGP
PKNKAKRPNRFSFITKGNKIESKPQKPTQEQRGADSSSDYVNIDFTERESNTPVRSTQRL
PDSWGVIADRRQSASSRYVNLQFGVPFPYPANNFSNLIRVIPGAIPPSLDGARWPLPPSA
TGGNAEEEGEYIEVIFNPAMIPAVPFADSAIRYDAETGRIYVVDPFSECCMDISLSPSRC
SEPLPVARLRQEEEQERRRPQSRSRSFFAGARAAVSAFPTDSLERDLSAFLASAAAAPTL
VVGRALAAASALAAAPGIGAAAAGLEATAGFDSASARWFLPVANAAAAAAAEAIRGFQNI
AEDWNPEGSNPSADPARGENEASGAAAAAAAAAAAPAPAPAPSPPPRRRPVPRPPEREDS
DDDDDTYVRMDFARPDNKKFDSPERGW
NT seq 3864 nt   +upstreamnt  +downstreamnt
atggcgagttgctccttcgttcgcgaccaagcgacaagtagtctgagagctgcagtagcg
gcagcagcggcagctccaccagcggcggcgaccacctcacttctttcctcggaaaccccg
accgcactcattgggaccggtncgtcttgtccgggagccatgtggctctccgcggccact
ggctcccggtcagactcggagtccgaggaggaggacctccccgtcggtacgaagttctgc
aaacgcgggtacctgcggaagcagaagcatgggcacaggcgatacttcgtgcttaaactc
gagaccgcagaacgccccgctcggctggaatactacgaaaatgccaggaagttccggcac
agtgtccgcgcagcggcggctgcagctgcggcggccgcctccggcgccgcggtgcccgcg
ctcatcccgccgcgacgcgtgataaccctgtaccagtgcttctccgtgagccagcgagcc
gacgcaaggtatcgacacctcattgcccttttcacccaggacgagtacttcgcaatggtg
gccgagaacgagtcggagcaggaaagctggtgcgtgctgcttagccgcctcatcctccag
agcaagcgccgccgctgcggcacgcccggcgcggagcccgaccaagaggggtccgcgcta
gcggtggcggcagcggcggcggagccacccttctacaaagatgtgtggcaggtagtaatc
aaacccaaggggctggggcacagaaaagagctgagcggcgtgttccggctttgcctgacc
gacgaagaggttctgttcgtgaggctaaacaccgaagtggccagtgtggtcgtgcagctc
ctgagtatccgtcgctgcgggcactcggagcagtatttctttttggaagtcggcaggtcc
accgtcatcggtccgggggagctgtggatgcaggtcgatgactgtgtggtagcccaaaac
atgcacgagctgtttttggagaagatgagagccttgtgtgcagacgaatacagagcccgc
tgccgcagctacagcatcggcacccacctgttaactctgctgtccgctaggaggcacctg
gattcgctgcccttccagcccggcggctggctcagaagatcccgctttgagttgtgccac
ctgagtgccattggtgacggggaagacgaaatgttcctcaccaggcgcttcatatcagcc
agagagcctgtaccccacttcaggcgaggaagacagcacctgcccagaatgcgcaggccc
aggagagcaatgtcagtgccagccagctgttttcgccacttaccacgtaagctgatggtt
gtccctgcagaagcccccaacgatggagcctgcctgtcttctgaagcatctggttctggt
aactctggggaggaaggcaaccctcagggcaatgaaagtcaggaaggaaatggaggcgac
tacatgcccatgaacaattggggctcaggaaatggccggggcacaggaggtggccagggc
tcaagtggccaaggctccagtagccagagttcaggaggaaaccagtgctccggtggggga
cagggctctggagggggtcagagctcaagtcatggccagggctcaggaggccagggtgca
ggaggaaaccagtgctcaggaaatggccagggcaccgcaggtggccatggctcaggcagc
ggccagggggctggaggtggtcatgggtcaggtggtggccaggggcctggaggtggccat
ggctcaggaggtggtggcaaggactctggagggggcaagggctcaagaagtggaaaaggc
tcagatggcaatgatgaacgtggaaaatctctgaaaaaaaggtcctactttagcaaatta
actcaaagcaaacaacagcaaatgctaccacctccaccacccccaccacccccaccttcc
ccacctcccccacctcccccacctccaccacctccaccacctccacccccaacacctgga
gcaactggtggaaaagggaagtccggaggcaggttccgactttatttttgtgctgacaga
ggagccacaaaagaacgcaaagaacctaaggatgtcaaagaggcagagacctctgaaggt
gcagctcggtatccccacagagccagagcttttgatgaagacgaagatgacccatacgtg
ccaatgaggccaggggttgctgcccctcttgcaagctccagcgattatatgccaatggct
cctcaaaatgtctctgcctccaaaaagcgccattctcgatcaccttttgaagattcaaga
gggtacatgatgatgtttcccagagcgagcccaccacctgcaccaactccccccaaagag
cctgagcctaataaagaggatgactcaaaggacaatgacagtgacagtgactacatgttc
atggctcctggagctggtgcaattccaaaaaaccccagaagtcctcagggtggctcttcg
tccaaaagttggagctcctacttctctctgccagacccttttcagagctcccccttggga
cagaatgaccacagtgagtatgtacccatgttacctgggaagttcctggggagggggcca
gacaaagaagcctcatttaatagaggccccaaagatgcaccttcaaagcctttagatcag
ggcttttgcccagagcctggagatggggggtcaccctcaaagccctccgatgatggaccc
ccaaagaacaaggctaagagacccaacagattttctttcattacaaaaggaaataaaatc
gagtcaaaaccacagaagcccacacaggagcagagaggcgctgacagctctagtgactac
gtcaacattgacttcactgaaagagagagcaacacaccagtccgctctactcaaagactg
ccagattcgtggggcgtaattgctgaccgcagacagtcagcctcttctcgttatgtgaat
cttcagttcggagtgccatttccatatccggcaaataacttctcaaatcttataagagtt
attccaggtgccattcccccatctctggacggtgctaggtggccacttcctcccagtgct
acaggtggcaacgctgaggaagagggcgagtacattgaagtgattttcaacccagcaatg
ataccagccgtgccttttgctgacagtgccattcgctatgatgctgaaacaggtcgaatc
tatgtggtcgacccattttctgagtgttgtatggacatttctctctcccccagccgatgc
tctgaaccgctacctgtggctaggttgcggcaggaagaagagcaagagagaagacgcccc
caaagccgatcccgaagtttctttgcaggcgccagagccgctgtctccgcttttccaact
gacagcctcgagagagatctttctgccttcttagcctctgccgccgctgcgccaacctta
gtggtgggccgggctttagccgcggcctccgccctggccgcggccccgggcatcggcgca
gccgccgcgggcttggaagcgaccgctggatttgactccgcctctgcccgctggtttcta
cctgttgctaatgctgctgccgccgccgccgctgaagccataagggggttccaaaacatt
gccgaagactggaatcccgaaggctcaaacccatctgcagaccctgccagaggtgaaaat
gaggcgagtggggctgccgctgccgctgccgctgccgctgccgctcccgctcccgctccc
gctccctcgccaccgcctcgccgccgcccagtgccaagacccccggagcgagaagattct
gacgacgacgacgacacttacgtgagaatggactttgccagacctgacaataagaagttc
gactctcccgaaagaggttggtaa

KEGG   Loxodonta africana (African savanna elephant): 100676904
Entry
100676904         CDS       T04351                                 

Gene name
IRS2
Definition
(RefSeq) insulin receptor substrate 2 isoform X3
  KO
K07187  insulin receptor substrate 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04068  FoxO signaling pathway
lav04140  Autophagy - animal
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100676904 (IRS2)
   04022 cGMP-PKG signaling pathway
    100676904 (IRS2)
   04152 AMPK signaling pathway
    100676904 (IRS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100676904 (IRS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100676904 (IRS2)
   04923 Regulation of lipolysis in adipocytes
    100676904 (IRS2)
   04920 Adipocytokine signaling pathway
    100676904 (IRS2)
   04935 Growth hormone synthesis, secretion and action
    100676904 (IRS2)
  09149 Aging
   04211 Longevity regulating pathway
    100676904 (IRS2)
   04213 Longevity regulating pathway - multiple species
    100676904 (IRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100676904 (IRS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100676904 (IRS2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100676904 (IRS2)
   04932 Non-alcoholic fatty liver disease
    100676904 (IRS2)
   04931 Insulin resistance
    100676904 (IRS2)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   100676904 (IRS2)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 100676904
NCBI-ProteinID: XP_003414087
LinkDB
Position
Unknown
AA seq 1364 aa
MASPPLNALPAPAGAAGGGGSAGGGGPNLNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGP
GGGGGGAGGDEPGAGGGQPPQPPRLEYYENEKKWKNKSGAPKRVIALDCCLNINKRADAK
HKYLIALYTKDEYFAVAAENEQEQEGWYRALTDLVNEGRAGAGDAPSARCAASSASCSAS
LPGPGAFGGSAGAADDNYGLIAPATSVYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTI
GFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHET
ILEAMKALKELFEFRPRSKSQSSGSSSTHPISVPGARRHHHLVNLPPSQTGLVRRSRTDS
LAATPPAAAGAKGSSCRVRTASEGDGSAGAAGAGGCRPVSVAGSPMSPGPMRTPLSRSHT
LSSGCGGHPSKMLLAPAGGALQHSRSMSMPVSHSPPAATSPGSLSSSSGHGSGSYSLPPG
PHPHLPHPLHHHQGQRPSSGSASASGSPSDPGFISLDEYGSSPGDLRAFCSHRSNTPESI
AETPPAREGSGGELYGYMTMDRPLSHCGRPYRRVSGDGAQDLDKGLRKRTYSLTTPARQR
AVPQPSSASLDEYTLMRATFSGSSGRLCPSCPASSPKVAYNPYPEDYGDIEIGSHRSSSS
NLGVDDGYMPMTPGVAPLVGGGSCKSDDYMPMSPTSVSAPKQILQPRVPTSALPPTGAGV
PAAASAAGRGFAVHGGSYKTSSPAESSPEDSRYMRMWCGSKLSMENPDSKLLSNGDYLNM
SPSDAGTSCTPPDFFSAALHSGGEVLKGVPGYCYSSLPRSYKAPYTCNGDNDQYVLMSSP
VGRILEEDRQEQQTSPQPLATPVSTQSASTFGPSGSSHIQPHHPAVPSPLRQSTSSRPEG
FLNQRCRAVRPTRLSLEGLQTLPSMHEYPLPPEPKSPGEYINIDFVEAGARLSPPAPPLL
ASAASSSSLLSASSPASSLGSGTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGTQSGDPV
GSLDGLLSPEASSPYPPLPPRPSATPSSASSQQPQPPLPPPPGELYRLPAVSVAATSQGP
SAASSSSSETGDNGDYTEMAFGVAATPPQPIAAPPKPESARVTSPTPGVKRLSLMDQVSG
VEAFLQASQPPDPHRGAKVIRADPQGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSAS
VENVSLRKSGEGGGSGVGVGLGGGDEPPRSPHQSQPALSVPSLPQQPRPWTQSQSVGLIG
CPGGSGSPMRRETSAGFQNGLNYIAIDVREETGLLPLQQQQQQPGEKNSWGRNHGLGGLI
NTVGGGSTSGVCGGPGPGTLPSTNAYASIDFLSHHLKEAAVVKE
NT seq 4095 nt   +upstreamnt  +downstreamnt
atggcgagcccgccgctgaacgcgctccccgccccggccggggccgcgggcggcggcggg
agcgcggggggcggcggccccaatctcaacaacaacaacaacaaccacagcgtgcgcaag
tgcggctacctgaggaagcagaaacacggccacaagcgcttcttcgtgctccgcggcccc
ggcggcggcggcggcggcgcgggcggcgacgagccgggggcgggcggggggcagccgccg
cagcccccccggctcgagtactacgagaacgagaagaagtggaagaacaagtcgggggcc
ccgaagcgggtgatcgcgctggactgctgcctgaacatcaacaagcgcgccgacgccaag
cacaagtacctcatcgccctctacaccaaggacgagtacttcgccgtggcggccgagaac
gagcaggagcaggagggctggtaccgcgcgctcaccgacctggtcaacgagggccgcgcg
ggcgccggcgacgcgccctccgcgcgctgcgccgccagctccgcgtcctgcagcgcctcc
ctgcccggccccggcgccttcgggggctcggccggcgccgccgacgacaactacgggctc
atcgcgcccgccacctcggtctaccgcgaggtctggcaggtgaacctgaagcccaagggc
ctgggccagagcaagaacctgaccggcgtgtaccgcctgtgcctgtcggcgcgcaccatc
ggcttcgtgaagctcaactgcgagcagccgtcggtcacgctgcagctgatgaacattcgc
cgctgcggccactcggatagcttcttcttcatcgaggtgggccgctcggccgtcacgggc
cccggcgagctgtggatgcaggccgacgactcggtggtggcgcagaacatccacgagacc
atcctggaggccatgaaggcgctcaaggagctcttcgagtttcggccgcgcagcaagagc
cagtcttcgggctcctcctccacgcaccccatcagcgtgcccggcgcgcggcgccaccac
cacctggtcaacctgccccccagccagaccggcctggtgcgccgctcgcgcaccgacagc
ctggccgccacgcctccggccgcggcgggcgccaagggcagctcctgccgggtgcgcacg
gccagcgagggagacggtagcgcgggcgcggcgggggcaggcggctgcaggcccgtgtcg
gtggcggggagccccatgagccccggaccgatgaggacgccactgagccgctcgcacacc
ctgagcagcggctgcggcggccatccgagcaagatgctgctggcgccggcagggggtgcc
ctgcaacacagccgctccatgtccatgcccgtgtcccactctcccccggcggccaccagc
cctggcagcctctcgtccagcagtgggcacggctcgggctcctactcgctgcctccaggc
ccacacccgcacctgccgcaccccctgcaccatcaccagggccagcggccctccagtggc
agtgcctctgcctcgggctcccccagcgatcccggtttcatatccctggatgagtatggc
tccagccctggcgacttgagagccttttgcagccaccgaagcaacactcctgagtccatc
gcagagaccccacctgccagagagggcagtgggggtgagctgtacgggtatatgaccatg
gacaggcccctgagccactgtggccgcccctaccgcagagtttcaggggacggggctcag
gacttggacaaagggctgaggaagaggacttattcactgaccacacctgctcgacagcgg
gcagtgccccagccctcctccgcatctctggatgagtacaccctgatgcgggctaccttt
tccggcagctcgggccgtctctgcccctcctgcccggcgtcctctcccaaagtggcttac
aacccctaccccgaggactacggagacatagagatcggctcccacaggagctccagcagt
aacctgggggtagatgatggctacatgccgatgacccctggtgtggccccgctcgtgggt
gggggtagctgtaagagtgacgactacatgcccatgagcccaaccagtgtgtctgccccc
aagcagatcctacagccccgggttcccacttcagccttgccccccactggagctggggta
ccagcagcagcctctgcagctgggagaggctttgcagtccacgggggcagttacaagacc
agctcccctgcagagagctccccagaggacagtcggtacatgcgtatgtggtgtggctcc
aagctgtccatggagaatcctgacagcaagctgctttccaatggggactacctcaacatg
tcccccagtgatgcgggtacttcctgtaccccacccgacttcttctcagctgccttgcac
agtggtggagaagtactcaagggagtacccggctactgctacagctccttgcctcggtct
tataaggctccttacacctgcaatggggacaacgaccagtatgtactcatgagctcccca
gtggggcggatcctggaagaggacagacaagagcaacagaccagtccgcagccgctggcc
accccagtgagcacccaatcggccagcaccttcgggcccagcgggagcagccacatccaa
cctcaccacccagcagtgccttcacccctgaggcagagcaccagcagccggccagaggga
ttcctgaaccaacgctgccgggcagtgcggcccactcgcctgtccctggaggggcttcag
actctgcccagcatgcacgaataccctctgcccccagaacccaagagccccggcgagtac
atcaacattgactttgtcgaggctggagctcgcctttccccaccggctcctccactgctg
gcgtcggcggcctcgtcttcctcgctgctgtcagccagtagcccagcctcctccctgggt
tctggcacccctgggaccagcagcgacagccggcaacgctctcctctctcagattacatg
aaccttgacttcagctcgcccaagtcacccaaaccgggtacccagagcggggaccccgtg
ggctccttggatggccttctgtcgcctgaggcctcctcgccctacccgccgctgccccca
cgcccctccgccactccttcttcagcctcctcccagcagccgcaaccacccctgccgcca
ccaccaggggagctgtaccgcctgcctgcggtgtctgtcgctgccacctcccagggcccc
agcgctgcctcgtcttcatcctccgagactggggataatggtgactacaccgagatggcc
tttggtgtggctgccaccccgccacaacctatcgcggcacccccaaagccagaaagtgcc
cgtgtgaccagcccgacgcctggcgtgaagaggctgagtctcatggatcaggtgtcaggg
gtcgaagccttcctgcaggctagccaacccccagacccacaccggggggccaaggtcatc
cgcgccgacccgcaggggggccgtcgccggcacagctcggagaccttctcctcaaccacc
actgtgacccccgtgtccccgtccttcgctcataatcctaagcgccacaactctgcctcc
gtggaaaatgtctctctcaggaaaagtggcgaaggcggtggcagtggtgtgggggtaggc
cttggagggggagatgagccacccagatccccccaccagtcgcagccggcactttctgtg
ccgtcgcttccccagcagccaaggccttggacacagagccagtctgtggggttaataggc
tgccctgggggcagtggttctcccatgcgtagggagacctctgctggcttccagaatggt
ctcaactacatcgccattgacgtgagggaggagacggggctgttacccctgcagcagcag
cagcagcagccaggagagaagaactcctggggccggaaccatggccttggtggtctcatc
aacactgtaggtggtggcagcaccagtggggtctgtggggggcctggccctggcaccctg
ccctccaccaacgcctacgcgagcattgacttcttgtcacatcacctgaaggaggctgct
gtcgtgaaagagtga

DBGET integrated database retrieval system