KEGG   Loxodonta africana (African savanna elephant): 100660400
Entry
100660400         CDS       T04351                                 

Gene name
NCK2
Definition
(RefSeq) cytoplasmic protein NCK2
  KO
K19862  NCK adaptor protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04360  Axon guidance
lav04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100660400 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100660400 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    100660400 (NCK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100660400 (NCK2)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100660400 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2 DUF5350
Other DBs
NCBI-GeneID: 100660400
NCBI-ProteinID: XP_003413662
UniProt: G3T5B4
LinkDB
Position
Unknown
AA seq 379 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANKTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTKRKTSARDASPTPSTDAEYPANGSSADRIYDLNIPAYVKF
AYLAEREDELSLVKGSRVIVMEKCSDGWWRGSYNGQIGWFPSNYVMEEVDEASADSPSFL
SLRKGAMSNGQGARVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNSR
GQIGLVPKNYVVVLSDGPALHPSHAPQISYTGPSATGRFAGREWYYGNVTRHQAECALNE
RGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYKK
APIFTSEHGEKLYLVKALQ
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgacagaagaagtgattgttatagcaaagtgggattacactgcccaacaggatcaggaa
cttgacatcaagaagaatgagcgcctgtggctgctggatgactccaagacatggtggcgg
gtgcgaaacgcagccaacaagacggggtacgtgccgtccaattatgtggaaagaaagaac
agcttgaagaagggctcgctcgtgaaaaatctgaaagacacactaggcctgggtaaaacg
aagaggaagacgagcgccagagatgcgtcccccacgcccagcacggacgccgagtacccc
gccaacgggagcagcgccgaccgcatctacgacctcaacatccccgcctacgtgaagttt
gcctatctcgccgagagggaggacgagctgtccctggtgaaggggtcccgggtcatcgtc
atggagaagtgcagcgacggctggtggcgaggaagctacaacgggcagatcgggtggttt
ccttccaactatgtcatggaggaggtggacgaagccagcgcggactcccccagcttcctg
agcctgcggaagggtgccatgagcaacggccagggcgcacgggtgctccacgtggtgcag
acgctctaccccttcagctccgtcaccgaagaggagctcaacttcgagaagggagaaacc
atggaagtgattgagaaacccgaaaatgaccccgagtggtggaaatgtaaaaattcccgg
gggcagattggccttgttcccaaaaactacgtggtggtcctcagtgacgggccggccctg
cacccttcccacgcccctcagataagctacaccggaccttcggccactggccgctttgcg
gggagagagtggtactatgggaacgtcacgcggcaccaggcggagtgcgccctcaacgag
cggggcgtggaaggggacttcctcattagagatagtgaatcttcgcccagtgacttctcc
gtctctctcaaagcatcagggaagaacaagcatttcaaggtgcagctggtggacaatgtc
tactgtatcgggcagcggcgatttcacaccatggacgagttggtggaacactacaaaaag
gcgccaatcttcaccagcgaacacggggaaaagttataccttgtcaaagcccttcagtga

KEGG   Loxodonta africana (African savanna elephant): 100666870
Entry
100666870         CDS       T04351                                 

Gene name
NCK1
Definition
(RefSeq) cytoplasmic protein NCK1 isoform X1
  KO
K07365  NCK adaptor protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04360  Axon guidance
lav04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100666870 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100666870 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100666870 (NCK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:lav04990]
    100666870 (NCK1)
Domain-containing proteins not elsewhere classified [BR:lav04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100666870 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 100666870
NCBI-ProteinID: XP_003420026
UniProt: G3TBH2
LinkDB
Position
Unknown
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVSNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMIG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEIALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggcccaacaagaacaagag
ctggacattaagaagaatgaaagattgtggcttctggatgattctaagtcctggtggcga
gtccgaaattccatgaataaaacaggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcggaaagcatctattgtaaaaaatctaaaggatacgttaggcattggaaaagtg
aaaagaaaacctagtgtgccagactctgcatctcctgctgatgacagctttgttgaccca
ggagaacgtctctatgacctcaacatgcctgcttatgtgaaatttaactacatggctgag
agagaagatgagttatctttgataaaaggcacgaaggtgattgtcatggagaaatgtagt
gatgggtggtggagaggaagctacaatggacaagttggatggttcccttcaaactatgta
actgaagaaggtgatagtcctttgggtgaccatgtgggttccctgtcagagaaattagca
gctgtcgtcagtaacctaaatactgggcaagtgttgcatgtggtacaggctctttaccca
ttcagctcgtccaatgatgaagaacttaattttgaaaaaggagatgtaatggatgttatt
gaaaaaccagaaaatgaccccgagtggtggaaatgcaggaagatcaatggaatgattggt
ctggtgccaaaaaactatgttaccattatgcagaataatccattaacctcaggtttggaa
ccatcacctccacagtgtgactacattaggccctcactcaccggaaagtttgctggcaac
ccatggtattatggtaaagtcaccaggcatcaagcagaaatagcattgaatgaaagaggg
cacgaaggggatttcctcattcgtgatagtgaatcttcgccaaatgatttctcagtttca
ctaaaagcacaggggaaaaacaagcattttaaagtccagctgaaagagactgtctactgc
attgggcagcgaaaattcagcaccatggaagaacttgtagaacattacaaaaaagcacca
atttttacaagcgaacaaggagaaaaattatatcttgtcaagcatttatcatga

DBGET integrated database retrieval system