KEGG   Loxodonta africana (African savanna elephant): 100660405
Entry
100660405         CDS       T04351                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3 isoform X1
  KO
K06493  integrin beta 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav04919  Thyroid hormone signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100660405 (ITGB3)
   04151 PI3K-Akt signaling pathway
    100660405 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100660405 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100660405 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100660405 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100660405 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100660405 (ITGB3)
   04611 Platelet activation
    100660405 (ITGB3)
   04613 Neutrophil extracellular trap formation
    100660405 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100660405 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100660405 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100660405 (ITGB3)
   05205 Proteoglycans in cancer
    100660405 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100660405 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    100660405 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100660405 (ITGB3)
   05414 Dilated cardiomyopathy
    100660405 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100660405 (ITGB3)
   05163 Human cytomegalovirus infection
    100660405 (ITGB3)
   05165 Human papillomavirus infection
    100660405 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660405 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100660405 (ITGB3)
   04515 Cell adhesion molecules [BR:lav04515]
    100660405 (ITGB3)
   04090 CD molecules [BR:lav04090]
    100660405 (ITGB3)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100660405 (ITGB3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100660405 (ITGB3)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100660405 (ITGB3)
CD molecules [BR:lav04090]
 Proteins
  100660405 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt EGF_2 I-EGF_1 PSI_integrin
Other DBs
NCBI-GeneID: 100660405
NCBI-ProteinID: XP_010592843
LinkDB
Position
Unknown
AA seq 789 aa
MRARRRARPLWAALLALGALAGVGVGGPSICATRGVSSCQQCLAVSPMCAWCSDKALPVG
TARCNLKENLLKDNCAPESIEFPISEARVLEDRPLSDKGSGDSSQVTQVTPQKIALRLRP
DDSKNFSVQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQSLGTNLASQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQNVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
IGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
KDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLDNEVIPGLKSCVGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLTVQVTFDCDCACQAQAQPHSPRCNNGNGT
FECGVCRCEPGWLGTQCECSEEDYRPSQQDECSPRGGQPLCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCTQPGSYGDTCEKCPTCPDACTFKKQCVECKKFDRGELHEENTCNRD
CRDEIELVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPDCPKGPDIL
VVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKQATSTF
TNITYRGNS
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgcgagcgcggcggcgggcccggccgctctgggccgctctgctggcgctgggggcgctg
gcgggcgtcggcgtcggagggcccagcatctgtgccacccgaggtgtgagctcctgccag
cagtgtttggctgtgagtcccatgtgtgcctggtgctcagacaaggctctgcctgtgggt
acggctcgttgtaacttgaaggagaacctgctgaaagacaactgtgccccggagtccatc
gagtttccgatcagtgaggcccgtgtactggaggatagacccctcagtgacaagggctct
ggagacagctcccaggttactcaagtcactccccagaagattgcgcttcggctacgacca
gacgattcgaagaatttctccgtccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcctactctatgaaggatgatctatggagcatccagagcctg
ggtacaaacctggcttcccagatgcgcaaactcaccagcaacctgcgtattggcttcggg
gcctttgtggacaaacctgtgtcaccatacatgtacatttctccaccagaggccctcaaa
aacccttgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acactaactgaccaggtgacccgcttcaatgaggaggtgaagaagcagaatgtgtcacga
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtatgtgatgaa
aagattggttggagaaacgatgcatctcacttgctggtgtttaccactgatgccaaaact
catatagcactggatggaaggctggcaggaattgtccaacccaatgatgggcagtgccac
attggcagtgacaaccattactctgcatccactaccatggattatccctccctggggctg
atgactgagaaactgtcccaaaaaaacatcaatttaatctttgcagtgactgaaaatgta
gtcaatctctaccagaattacagtgaacttatcccagggaccacagtgggggttctctcc
aaagactccagcaacgtcctccagctcatcgttgacgcctatgggaaaatccgctctaaa
gtagagctggaagtgcgtgacctccctgaggagttgtctctatccttcaacgccacgtgc
ctcgacaacgaggtcatcccaggcctcaagtcttgtgttggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtacgtggctgccctcaggagaaggagaagtccttc
accatcaagcctgtgggcttcaaagacagcctcaccgtccaggtcaccttcgactgtgac
tgtgcctgccaggcccaggcccagcctcacagcccccgctgcaacaatggcaatgggacc
ttcgagtgtggtgtgtgccgctgtgagcctggctggctggggacccagtgcgagtgctca
gaggaggactaccgcccctcccagcaggatgagtgcagcccccgggggggccagcccctc
tgcagccagcgcggagagtgcctgtgtggccagtgtgtctgccacagcagtgactttggc
aagatcacgggcaaatactgcgagtgtgatgacttctcctgtgtccgatacaagggggag
atgtgctcgggtcatggccagtgcagctgtggggactgcctctgtgactccgactggacc
ggctactactgcaactgtaccacacgcaccgacacctgcatgtccagcaatgggctgctg
tgcagtggccgtggcaaatgcgaatgcggcagctgcgtctgcacccagccaggctcctac
ggggacacctgtgagaagtgccccacctgccctgatgcctgcacctttaagaagcagtgt
gtggagtgtaagaagtttgaccggggagagctacacgaggaaaacacctgtaatcgtgac
tgccgtgatgaaattgaacttgtgaaggagcttaaggacactggaaaggatgcagtgaat
tgtacctacaagaatgaggatgactgcgtggtcagattccagtattatgaagactccagt
ggaaagtccatcctctatgtggtggaagaaccagattgtcccaagggcccggacatcctg
gtggtcttgctttcagtgatgggggccattctgctcatcggccttgctactctgctcatc
tggaaactcctcatcaccatccacgaccggaaggagtttgctaaatttgaggaagagcga
gccagagcaaaatgggacacagccaacaacccactgtataaacaggccacatcgaccttc
accaatatcacctaccggggcaattcataa

KEGG   Loxodonta africana (African savanna elephant): 100661118
Entry
100661118         CDS       T04351                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7 isoform X1
  KO
K06590  integrin beta 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04672  Intestinal immune network for IgA production
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05202  Transcriptional misregulation in cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100661118 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100661118 (ITGB7)
   04514 Cell adhesion molecules
    100661118 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100661118 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100661118 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100661118 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100661118 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100661118 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100661118 (ITGB7)
   05414 Dilated cardiomyopathy
    100661118 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100661118 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100661118 (ITGB7)
   04515 Cell adhesion molecules [BR:lav04515]
    100661118 (ITGB7)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100661118 (ITGB7)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100661118 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 100661118
NCBI-ProteinID: XP_003405516
LinkDB
Position
Unknown
AA seq 797 aa
MVALSMVIWSLLALSRAERELDTKIPSLGEATEWGDPDLSLLGSCQPAPSCQQCILSHPS
CAWCKQLNFTASGEAEERRCAGREELLARGCPLEELEEPRSRQEVLQDYPFSQGARGEGT
VQLAPQRVRVMLRPGEPQRLQVRFLRAEGYPVDLYYLMDLSYSMKDDLEQVRQLGHDLLL
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLEPCQPPFSFHHVLSLTTEAK
VFEQEVGLQNVSGNLDSPEGGFDAILQAAVCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFRPSDGRCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYQELS
KLIPKSTVGELSENSSNVLQLIMDAYNSLSSTVTLQHVSPLPGVHISYESQCGGPKKREG
ETGDRGQCNHVRINQTVNFWVTLQAAHCFTEPQLLRFRALGFSEELTVELHTLCDCNCSD
TQPQAAHCSDGQGHLQCGVCSCAPGRRGRLCECSEAELSSPDLESGCRAPNGTGPLCSGK
GRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
SVDSCVSSEGGLCSGHGHCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
PLTTNCSMACAHANVTLALAPILDDGWCKERTLDNQLFFFLVEEAGGRVVLRVRPQEKGA
DHTQAIVLGCVGGIVAVGLVLVLAYRISVEIYDRREYSRFEKEQQQLNWNQDNNPLYKSA
ITTTINPRFQGRESPLL
NT seq 2394 nt   +upstreamnt  +downstreamnt
atggtagctttatcgatggtcatttggtccctgttggccctgagcagagctgagagggag
ttggacaccaagatcccatctctaggggaggccacagaatggggggatcctgacctgtct
ctgctggggtcctgccagccagccccctcctgccagcagtgcatcctatcacaccccagc
tgtgcgtggtgcaagcaactgaacttcacggcgtcgggggaggcggaggagcggcgctgc
gcagggcgggaggagctgctggcccggggctgtcccctagaggagctggaggagccccgc
agccggcaggaggtgctgcaggactacccgttcagccagggcgcccgcggcgaagggacc
gtccagctggctccgcagcgggtccgggtcatgctgcgcccaggggagccccagcgactc
caggtccgcttcctccgtgcggagggctacccagtggacctgtactacctcatggacctg
agctactccatgaaggacgacctggagcaagtgcgccagctcgggcacgacctgttgctc
aggctgcaggaggtcacccattccgttcgcattggttttggctcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccttcgaagcttcgccacccctgtcccacccggctc
gagccctgccagccacccttcagctttcaccatgtgctgtccctgacgactgaggcgaag
gtctttgagcaggaggtggggctccagaatgtgtctggcaacctggactcgcccgaaggt
ggctttgacgccattctgcaggctgcagtctgccaggagcagattggctggagaaacgtg
tcccggctgctggtgttcacctcagatgacacattccacacagctggggatgggaagtta
ggtggcattttcaggcccagcgatgggcgctgccacttggacagcaatggcctctatagc
cgcagcccggagtttgattacccctccgtgggtcaggtagcccaggccctctctgcggca
aatatccagcccatcttcgctgtcaccagtgccacgctgcctgtctaccaggagctgagt
aaattgattcctaaatccacagttggggagctgagcgagaactccagcaatgtgctgcag
ctcatcatggatgcttataacagcttgtcgtccactgtgacccttcaacacgtttcaccc
cttcctggggtccacatctcctacgaatcccagtgtggcggtcccaagaagagggagggt
gagactggggatcggggccagtgcaatcacgtccgaatcaaccagacggtgaatttctgg
gttactctccaagctgcccactgcttcacagagccccagcttctgaggttccgggccctt
ggcttctccgaggagctgactgtggagttgcacacactgtgtgactgtaactgcagtgac
acccagcctcaggctgcccactgcagtgatggccaggggcacttgcagtgcggggtgtgc
agctgtgcccccgggcgtcggggtcggctctgtgagtgctctgaggctgagctgtcctcc
ccggatctggaatctgggtgccgggcccccaatgggacaggccctctatgcagcgggaag
ggtcggtgccagtgtggacgctgtagctgcagtggacaaagctccgggcgtctatgcgag
tgtgatgatgccagctgtgagcgacacgagggcattctctgtggaggctttgggcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcctgcgagtgcagtggg
tccgtggacagttgtgtcagttctgaaggaggcctctgcagtgggcatggacactgcaaa
tgcaaccgctgccagtgcctggacggctactacggtgctttatgtgatcagtgcccaggc
tgcaagacaccatgcgagagacacagggactgtgcagagtgcggagccttcgggactggt
cccctgaccaccaattgcagcatggcttgcgcccatgccaacgtgactctggctttggcc
cccatcctggatgatggctggtgcaaagagaggaccctggacaaccagctattcttcttc
ctggtggaggaggccggaggcagggtggtgttgagagtgagaccccaggaaaagggagca
gaccacacccaggccattgtactgggctgtgtagggggcatcgtggcagtgggcctggtg
ctggtcctggcttaccggatctcagtggaaatttatgatcgccgggaatacagtcgcttt
gagaaggagcagcagcaacttaactggaaccaggacaacaatcctctctacaaaagcgcc
atcacgacaaccatcaatcctcgctttcaaggaagagagagtccccttctctga

KEGG   Loxodonta africana (African savanna elephant): 100661984
Entry
100661984         CDS       T04351                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 isoform X1
  KO
K06591  integrin beta 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100661984 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100661984 (ITGB8)
   04514 Cell adhesion molecules
    100661984 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100661984 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100661984 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100661984 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100661984 (ITGB8)
   05414 Dilated cardiomyopathy
    100661984 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100661984 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100661984 (ITGB8)
   04515 Cell adhesion molecules [BR:lav04515]
    100661984 (ITGB8)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100661984 (ITGB8)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100661984 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100661984
NCBI-ProteinID: XP_003407135
UniProt: G3SN79
LinkDB
Position
Unknown
AA seq 767 aa
MCGWALTFFTVAFVCLQNCRRGPAQALRAAWVFSVVLGLGQSEDNRCADSNTASCAKCLA
LGPECGWCAQEVFVTGGSRSERCDIVSNLISKGCSVDSIEYPSVRVIPSGNEINTQVTPG
EVSIQLHPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMSLFS
LDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHMKNNVYVKSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGQIESKAANLNNLVVDAYQKLISEVKVQVENQVQGVYFNVTAICPDGSRKPGTDGCRN
VTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETTKIHIHRNCSCQCDDRREAKGKC
VDENFLDTNCFQCDDNKCHFDEDQFPSESCKSHKDQPVCSGRGVCICGRCLCHKTKLGKV
YGKYCEKDDFSCPYYLGNLCAGHGECEAGRCQCHSGWEGDWCQCPSASAQHCVNSKGQVC
SGRGTCVCGRCECTDPRSIGRFCEHCPSCNTACNENWNCVQCLHPHNLSQAILDQCKSSC
ALMEHHSVDQTPECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWSSNKIKSSADY
RGPASKKDKLILHSVCTRAVTYRREKPEEIKIDISKLNAHETFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgcggctgggccctgactttttttaccgtcgcatttgtctgcctgcaaaactgccgg
cgaggtcctgcccaggctctccgggcggcctgggtgttttcagttgttcttggactgggc
caaagtgaagacaatagatgtgcggattcaaacacagcatcctgtgccaagtgccttgcg
ctgggtccggaatgtggatggtgtgctcaagaggttttcgttacaggtggatcaaggagt
gaacgttgtgatattgtttccaatttaatcagcaaaggctgctcagttgattcaatagaa
tacccgtctgtgcgtgtaataccaagtggaaatgaaattaatacccaggtgacaccagga
gaagtgtcaatccagctgcatccaggagctgaagctaattttatgttgaaaattcatcct
ctgaagaaatatcctgtggatctttattatctagttgatgtctcagcatcgatgcacaat
aatatagaaaaattaaattctgttggaaatgatttatctagaaaaatgtcacttttctcc
cttgacttccgccttggatttggctcatacgttgataaaaccgtttcaccatacattagc
atccacccagaaaggattcataatcagtgcagtgactataacttagactgcatgcctccc
catgggtacattcatgtgctgtctttgacggagaacattaccgagtttgaaaaagcagtt
cacagacagaagatctctggaaatatcgatacgccagaaggaggttttgacgccatgctt
caggcagccgtctgtgagagtcatattggatggcgaaaagaagctaagagattgctgctg
gtgatgacagatcagacatctcatcttgctcttgatagcaaactggcaggcatagtggtg
ccaaacgatgggaactgccatatgaaaaacaacgtctacgtcaagtccacaagcatggaa
catccctcactaggccaactttcagaaaaattaatagacaacaacatcaatgtcattttt
gcagttcaggggaaacagtttcattggtataaggatcttctaccactcttgcctggcacc
atcgctggtcaaatagaatcaaaggctgcaaacctcaataatttggtagtagacgcctat
cagaaactcatttcagaagtgaaagttcaggtggaaaaccaggtacaaggcgtctatttt
aacgttaccgccatctgtccagatgggtccagaaagccaggcacagatggatgcagaaac
gtgaccagcaatgacgaagttcttttcaatgtaacagttacaatgaaaaaatgtgatgtc
acaggaggaaaaaactatgcaataatcaagcctattggtttcaatgaaaccaccaaaatt
catatacatagaaactgcagctgtcagtgtgatgacagaagagaagctaaaggaaaatgt
gtagatgaaaattttctggacactaactgtttccagtgtgatgacaataaatgtcatttt
gatgaagaccagtttccttctgagagttgcaagtcgcacaaggatcaacctgtttgcagc
ggtcgaggagtttgtatttgtgggagatgtttatgtcacaaaactaagcttggaaaagtg
tatggaaaatactgcgaaaaggatgatttttcttgtccatattaccttggaaatctgtgt
gctggtcatggagagtgtgaagctggcagatgtcagtgccacagtggctgggagggggat
tggtgccagtgcccgtcggcatcagcccaacactgtgtcaactcaaagggccaagtatgc
agcgggagaggcacctgtgtgtgcggcaggtgcgagtgtaccgatcccaggagcatcggc
cgtttctgtgaacactgcccctcgtgtaatacagcgtgcaatgaaaactggaattgtgtg
caatgccttcaccctcacaatctctctcaagctatacttgatcagtgtaaatcctcgtgt
gctctcatggaacaccattctgtggaccaaacaccagaatgtttctctagcccaagctat
ttaagaatatttttcatcatctttatagtaacattcttgattgggttgcttaaagtcctt
atcatcagacaggtgatactacaatggagtagtaataaaattaagtcctcggcagattat
agagggccagcctcaaaaaaggataagttgattctgcatagtgtttgcacaagagcagta
acctaccgacgtgagaagcctgaagaaataaaaatagatatcagcaaattaaatgctcat
gaaactttccgttgcaacttctaa

KEGG   Loxodonta africana (African savanna elephant): 100664907
Entry
100664907         CDS       T04351                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 isoform X1
  KO
K06589  integrin beta 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100664907 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100664907 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664907 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664907 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100664907 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100664907 (ITGB6)
   05414 Dilated cardiomyopathy
    100664907 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100664907 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664907 (ITGB6)
   04515 Cell adhesion molecules [BR:lav04515]
    100664907 (ITGB6)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100664907 (ITGB6)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100664907 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 100664907
NCBI-ProteinID: XP_003406050
UniProt: G3SPD2
LinkDB
Position
Unknown
AA seq 788 aa
MGIELFCLFLLFLGRNAYVQGGCALGGAETCAGCLLIGPHCAWCSQENFTHPSGAGERCD
TPANLLAKGCQLTFIENPVSQVEILKNKPLSVGRQKNSSNIVQITPQSLILKLRPGGEQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNSILFPHQKKCSHMKVGDTASFNVT
LSIPNCERKSRHIVIKPVGLGDTLEIHVSPECNCDCQKEVEVNSSKCHNGNGSFQCGVCA
CNPGHMGPRCECEEDTLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCTNPGASGPACERCPTCGDPCNSKRSCIECHLSADGQSQEECVDKCKLAGSTISEGE
DFSKESSVSCSLQGENDCLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIILGVSLAIL
LIGFVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLFTDG
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggggattgaactgttttgcctgttccttctatttctaggaaggaatgcttacgtgcaa
ggtggctgtgccctgggaggggcagagacctgtgcaggctgcttactcattggacctcat
tgtgcctggtgttctcaggagaattttacccacccatcaggagctggtgaaaggtgcgat
accccagcgaatcttttagctaaaggatgtcaattaaccttcatcgaaaaccctgtttcc
caagtagaaatacttaagaataagcctctcagtgtcggcagacagaaaaatagttccaac
attgttcagatcacgcctcaaagcttgattcttaagttaagaccaggtggagaacagacc
ctgcaggtgcatgtccgccagacagaggattacccagtggacttgtattacctcatggac
ctctcagcctccatggatgacgaccttaacacaatcaaagagctgggctccctgctttcg
aaggagatgtctaaattaactagcaactttagactcggcttcggctcttttgtggaaaaa
cctgtctccccttttatgaaaacaacaccagaggaaatcgccaacccttgcagtagtatt
ccatacttctgcttacctacatttggattcaagcatattttgccactgacaaatgatgcc
gaaaggttcaatgaaattgtgaagaatcagaaaatttctgcgaatattgacacaccagaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccacctcctggtctttgtgagtgatgcagattctcattttgggatggacagc
aaactggcaggcatcgtgattcctaacgacggactctgccacttggacagcaagaatgaa
tattccatgtcaactgttttggaatatccaacaattgggcaactcattgataagctggtg
caaaataacgtattactgatctttgctgtgacccaagaacaagtacatttatatgagaat
tacgcaaaacttattcctggagctacggtagggctacttcagaaggactctggaaacatt
cttcagctgatcatctcggcttacgaagaactgcggtctgaggtagaactggaagtactg
ggagatacagaaggactcaacctgtcattcacagctatctgcaacaatagcatcctcttc
ccacaccaaaagaaatgctcgcacatgaaggtcggagacacggcttccttcaacgtgact
ttgagtataccaaactgtgagaggaaaagcaggcacatagtcataaagcccgtggggcta
ggggacaccctagaaatccatgtcagtccggaatgcaactgcgactgtcagaaagaagtg
gaagtgaacagctccaaatgccacaacgggaacggctccttccagtgtggggtgtgtgcc
tgtaacccgggccacatgggtcctcgctgcgagtgtgaagaggacacgctgagcacagat
tcctgcaaggaggccccagaccatccctcgtgtagtggaaggggcgactgttactgcggg
cagtgtatctgccacttgtctccctatggaaacatctatgggccttactgccagtgcgac
aacttctcctgcgtgaggcacaaagggctgctctgtggagataacggcgactgtgactgt
ggcgagtgcgtgtgcaggagcggctggacgggggagtactgtaactgcaccaccagcaca
gactcatgtgtctctgaagacggggtgctctgcagtgggcgaggggactgcgtctgtggc
aagtgtgtgtgcacgaaccccggagcctcagggcccgcctgtgaacgatgtcctacctgt
ggggacccctgtaattctaaacggagctgtattgaatgccacttgtctgcagatggccag
tcccaagaagaatgtgttgacaaatgcaaactagctggttcgaccatcagtgaaggagaa
gatttctcaaaggagagttctgtttcctgctctctgcaaggagaaaatgactgtctcatt
acattcctaataactacagataacgaggggaaaaccatcattcacagcatcaacgagaaa
gattgtccaaagcctccaaacatccccatgattatattgggcgtttcactggctattctt
ctcattgggtttgtcctactatgcatttggaagctgctggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaggccgaacgatcaaaggccaaatggcaaacaggaaccaatcca
ctgtacagaggctctaccagtacctttaaaaatgtaacctataaacacagggaaaaacaa
aaggtggaccttttcacagatgggtag

KEGG   Loxodonta africana (African savanna elephant): 100664978
Entry
100664978         CDS       T04351                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04530  Tight junction
lav04611  Platelet activation
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav05100  Bacterial invasion of epithelial cells
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05145  Toxoplasmosis
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100664978 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100664978 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100664978 (ITGB1)
   04514 Cell adhesion molecules
    100664978 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100664978 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664978 (ITGB1)
   04530 Tight junction
    100664978 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664978 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100664978 (ITGB1)
   04670 Leukocyte transendothelial migration
    100664978 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    100664978 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664978 (ITGB1)
   05205 Proteoglycans in cancer
    100664978 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100664978 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100664978 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100664978 (ITGB1)
   05414 Dilated cardiomyopathy
    100664978 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100664978 (ITGB1)
   05133 Pertussis
    100664978 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100664978 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100664978 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100664978 (ITGB1)
   05140 Leishmaniasis
    100664978 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100664978 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664978 (ITGB1)
   04515 Cell adhesion molecules [BR:lav04515]
    100664978 (ITGB1)
   04090 CD molecules [BR:lav04090]
    100664978 (ITGB1)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100664978 (ITGB1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100664978 (ITGB1)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100664978 (ITGB1)
CD molecules [BR:lav04090]
 Proteins
  100664978 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100664978
NCBI-ProteinID: XP_003420767
UniProt: G3TK94
LinkDB
Position
Unknown
AA seq 798 aa
MNLQLIFWIGLISSICYVFSQTDENRCLKANAKSCGECIQAGPNCGWCTNLTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKNIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMKRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIHLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPNKNSETIKIKPQGFTEDVEIILQFICECECQSKGIPESPQCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAHCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGEVCGGNGVCKCRVCECNPNYTGSACECSLDTSSCM
AKNGQICNGRGVCECGTCKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKEK
CADECSHFNLTKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgattagctcaatttgctatgtgtttagc
caaacagatgaaaatagatgtttaaaagcaaatgcaaaatcatgtggagaatgtatacaa
gcagggccaaattgtggatggtgtacaaatttaacgtttttacaagagggaatgcctacc
tctgcccgatgtgatgatttagaagccttaaaaaagaagggttgccatccagatgacata
gaaaatcccagaggctccaaaaatataaagaaaaataaaaatgtaacaaatcgtagcaaa
ggaacagcagagaagctccagccagaagatattactcagatccagccacagcagttggtt
ttgcagctacgatcaggtgagccacagacatttacattaaaattcaagcgagctgaagac
taccccattgatctctactacctcatggacctctcctactccatgaaggatgatttggag
aacgtgaaaagtctggggacagatctgatgaatgaaatgaagaggattacttcagacttc
agaattgggtttggctcgtttgtggagaagactgtaatgccttacattagtacaacaccg
gctaaactcaggaacccttgcacaagtgaacagaactgcaccagcccctttagctataaa
aatgtgcttagtcttactgataaaggggaagtattcaatgaacttgttggtaaacagcgg
atatctggaaatttggattctccagagggtggctttgatgcaatcatgcaagttgcagtt
tgtggatcattgattggctggagaaacgttacacggctgctggtgttttccacggatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccgaacgacgggcag
tgtcacctggagaataatgtatacacaatgagccattattacgattatccttctattgct
cacctggtccagaaactcagtgaaaataacattcagacgatttttgcagtgactgaagaa
tttcagcctgtttacaaggaactgaaaaatttgattccaaagtcagcggtaggaacatta
tctgcaaattcgagcaatgtaattcatctgatcatagatgcatataattccctttcctca
gaagtcattttggaaaacagcaaattgccagaaggagtaacaataaattataaatcttac
tgcaaaaatggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataaatgtccaaataagaattct
gaaaccattaaaattaagcctcagggcttcacggaagacgtagagattatccttcagttc
atctgtgaatgcgaatgccaaagtaaaggcatccctgaaagtccacagtgccatgaagga
aacgggacgtttgagtgtggcgcttgcaggtgcaacgagggccgtgttggtaggcattgt
gaatgtagcacggatgaagtgaacagtgaagacatggatgctcactgcaggaaggaaaac
agctcagaaatctgtagtaacaatggagagtgtgtctgtggacagtgtgtctgtagaaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgacaatttcaactgt
gacagatccaatggcgaagtttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgaa
tgcaaccccaactacactggcagtgcttgcgagtgctctttggatacttcttcgtgcatg
gccaaaaacgggcagatctgcaacggacgaggggtctgcgagtgtggcacctgtaaatgc
acagaccccaaatttcaggggccaacgtgcgagatgtgtcagacctgccttggcgtctgt
gctgaacataaagaatgtgttcagtgcagagccttcaataaaggagagaagaaagaaaag
tgtgcagatgaatgttcacatttcaaccttaccaaggtggaaaaccgggacaagttaccc
cagccgggccaggtcgatcccctgtcccattgtaaggagaaggacgtggacgactgctgg
ttctatttcacatactcagtgaatgggaacaatgaggccattgttcatgttgtggagact
ccagagtgtcccactggtccagacataattccaatcgtagctggtgttgttgctgggatt
gttcttattggccttgcgttgctgctgatttggaagcttttaatgatcattcatgacagg
agggaattcgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtgacaactgttgtcaatccgaagtatgaggggaaatga

KEGG   Loxodonta africana (African savanna elephant): 100671877
Entry
100671877         CDS       T04351                                 

Gene name
ITGB4
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin beta-4
  KO
K06525  integrin beta 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100671877 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100671877 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100671877 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100671877 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100671877 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100671877 (ITGB4)
   05414 Dilated cardiomyopathy
    100671877 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100671877 (ITGB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100671877 (ITGB4)
   04515 Cell adhesion molecules [BR:lav04515]
    100671877 (ITGB4)
   04090 CD molecules [BR:lav04090]
    100671877 (ITGB4)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100671877 (ITGB4)
  Exosomal proteins of bladder cancer cells
   100671877 (ITGB4)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100671877 (ITGB4)
CD molecules [BR:lav04090]
 Proteins
  100671877 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 100671877
NCBI-ProteinID: XP_023412500
LinkDB
Position
Unknown
AA seq 1671 aa
MVSRKRSEPRFPHWPDGNGSSSPAELTGWTSVEMSYVGCSVTGGRGWEGLSPSLWTRLLL
VALLSVSFPGHMGTRCKKTQVKSCTECIRVDKDCAYCTDEMFKERRCNTQAELLAAGCRQ
ESVVIMESSFEITEETHIDTSLKRSQVSPQGLRVRLRPGEERHFEFEVFEPLESPVDLYI
LMDFSNSMSDDLANLKQMGQNLGMLGQCRGQGARRTGGLNQIAAQEACTQDSCTHPTRRD
RMSEPQENILPHYQGRVPTRSAQPLGTSGKARGKRISGTLDAPEGGFDAILQTAVCTRNI
GWRPESTHLLVFSTESAFHYESDGANVLAGIMRRNDEDCHLDASGTYTHYKTQDYPSVPT
LVRLLGKHNIIPIFAVTNHSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLQEAFEAIRSN
LDIRALDSPRGVRTEVTSEMFQKTKTGSFHIERGKVGTYHVQLRAAEDVEGTHVCQLSEG
DQRGNVHLKPSFSDGLKMDVGIICDKCTCELQKEIQSPFCTFNGDFMCGHCVCNEGWLQG
SAPTVPPWKVDSLGLQVGMLFSSSFPPLSADRGHCTMGQCVCEPGWTGPSCDCPLSNATC
TDSNGGICNGRGHCECGRCHCNQQSLYTDTTCEINYSAKKGHACEECSFKVKMVDELKKA
EEVVEYCSFRDEDDDCTYSYTVEGDGEPGPNSTVLVHKKKDCPPGSFWWLIPLLIFLLLL
LALLLLLCWKYCACCKVGLGGAGXAPCPAGHMVGFKEDHYMLRENLMASDHLDTPMLRSG
NLKGRDTVRWKITNNVQRPGFATRSASTNPTELVPYGLSLRLARLCTENLLKPDTRECDQ
LRQEVEENLNEVYRQVTGAQKLQQTTFRQQPNAGKKQDHTIVDTVLMAPRSAKQTLLSLT
EKQVEQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLV
EAIDVPSGTATLGRRLVNITVIKEQASGVVSFEKPEYFVSRGEQVARIPIIRRIIDSGKS
QVSYRTQDNTAHGNRDYIPVEGELLFHAGETWKELQVKLLELQEMDSLLRGRQTRRFHIH
LSNPKFGARLGQPHSATVVMGDGDELDRSLTSRTVSSTPLLRGDPAAPQNPNAKAAGSRK
IHFNWLPPPGKPMGYKVKYWIQGDSEAEAQMIDSKVPSVELTNLYPYCDYEMKVCAYGPQ
GESPYSPLVTCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGPVNE
DNRPIGPMKKVLVDSPKRRMLLIENLRESQPYRYTVKARNGAGWGPEREAFINLATQPKR
PMSIPIIPDIPIVDAQSGEDYNSFLMYSDEVLRSPGSSQRPSVSDDTEHLVNGRMDFPGS
ANSLHRMTAANAAYGTHLSPHLPHRVLSTSSTLTRDYHSLTRTEHSHSHSATLPRDYSTL
TSLSSHGLPPIWEAGRSRLPLSWALGARSRARVKVLPPSGDSRDSIILAGQPAAPSWGPD
SRTAAGVPDTPTRLVFSALGPTSLKVSWQEPQCERALQGYSVEYQLLNGGELHRLNIPNP
SQTSVLVEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQSPLCPLPGSAFTLST
PSAPGPLVFTALSPDSLQLSWERPRRPLGDILGYLVTCEIAHGGGAAPPSG
NT seq 5016 nt   +upstreamnt  +downstreamnt
atggtgtcacggaagcgctcagagcctcgatttccacactggcccgatggcaatggctcc
agctcccctgcagagctgacaggatggaccagtgtggagatgtcatatgtgggctgttct
gttacaggaggaagaggatgggaggggctgagccccagcctatggaccaggctgctgctg
gtggccctgctgagcgtcagcttccccgggcacatggggacccgctgcaagaagactcag
gtgaagagctgcactgagtgtatccgcgtggacaaggactgcgcctactgcaccgatgag
atgttcaaggagcggcgctgcaacacccaggcagagctgctggctgcgggctgccggcag
gagagcgtggtgatcatggagagtagctttgagatcacagaggagacccacattgacaca
agcctgaaacgcagtcaggtgtcaccccaaggactgcgggtccggctgcggccaggagag
gagcggcacttcgagtttgaggtgtttgaaccccttgagagtcccgtggacctgtacatc
ctcatggacttctccaactccatgtccgacgatctggccaacctcaagcagatggggcag
aacctgggtatgctgggccagtgtagaggacagggggctcggagaacaggtggcctcaac
cagatagctgctcaggaggcctgcactcaggacagctgcacccaccccacaaggagagac
aggatgtctgagccccaagagaacatcctcccccattatcagggaagggttccgaccaga
tctgcccaaccactggggacatcaggaaaggcccgggggaagcggatctcaggcaccctg
gatgctccagagggaggctttgatgccatcctgcagacagctgtgtgcacgaggaacatc
ggctggcgcccagagagcacccacctgctggtgttctccaccgagtcggccttccactac
gagtccgatggcgccaacgtgctggcgggcatcatgaggcgcaatgacgaagactgccac
ctggatgcctcaggcacctacacccactacaagacgcaggactacccatcggtgcccacc
ctggtgcgcctacttggcaaacacaacatcatccccatctttgccgtcaccaaccactcc
tacagctactacgagaagctgcacacatactttcccgtctcctcactgggcgtgctgcag
gaggactcatccaacattgtggagctgctgcaggaggccttcgaggccattcgctccaac
ctggacatccgggcgttggacagcccccgaggggtgcggacagaggtcacctccgagatg
ttccaaaagacaaagactgggtccttccacatcgagcgtgggaaagtgggcacataccac
gtgcagctgcgagccgctgaggacgtggaggggacccacgtgtgccaactgtcagaaggt
gaccagagagggaacgtccacctgaagccttccttctctgacggtctcaagatggacgtg
ggcatcatctgtgacaagtgcacctgcgagctgcaaaaagagatacagtcacctttctgc
accttcaacggggatttcatgtgtggacactgtgtgtgcaatgagggctggctccaaggc
tcagctccaacagttcctccctggaaggtagacagcctgggactgcaggtgggaatgttg
ttctcctcttcctttcctcccctctctgcagaccggggacactgtaccatgggccagtgt
gtgtgtgagcctggctggacgggaccaagctgcgactgccccctcagcaatgccacctgc
actgacagcaatgggggcatctgtaatgggcgtggccactgcgagtgtggacgctgccac
tgcaaccagcagtcgctgtacacggacaccacctgcgagatcaattactcggcgaagaag
gggcatgcatgtgaggagtgcagcttcaaggtcaagatggtggatgagctgaagaaagcg
gaggaggttgtggagtactgctccttccgggacgaggatgacgactgcacctacagctac
acggtggagggcgacggggagccagggcccaacagcaccgtcctggtgcacaagaagaag
gactgccctcccggctctttctggtggcttatccccctactcatcttcctcctgctgctc
ctggcgctgctgctgctgctctgctggaagtactgcgcctgctgcaaggtgggtctaggg
ggcgcaggctgagctccctgtcccgcaggccacatggtgggcttcaaggaagaccactac
atgctgcgggagaacctgatggcctccgaccacctggacacgcccatgctgcgcagcggc
aacctcaaggggcgggacaccgtccgctggaagatcaccaacaacgtgcagcgacctggc
ttcgccacccgctcggccagcaccaaccccacagagctggtgccctacgggctgtccctg
cgccttgcccgcctctgcactgagaacctgctgaagcctgacacccgtgagtgtgaccag
ctgcgccaggaggtggaggaaaatctgaatgaggtgtacagacaggtcacaggcgcccaa
aagctccagcaaacgacgttccggcagcagcccaatgccgggaaaaagcaggaccataca
attgtggacacagtgctgatggcaccccgctcggccaagcagaccctgctgagcctgacg
gagaagcaggtagagcagggggccttccatgagctcaaggtggcccctggctactacacc
ctcactgcagaccaggatgcccggggcatggtggagttccaggagggcgtggagctggtg
gacgtgcgcgtgccacttttcatccggcctgaggatgatgacgagaagcagctgctggtg
gaggccatcgacgtgccctccggcaccgccacccttggccgccgcctggtcaacatcacc
gtcatcaaggagcaagccagtggggtggtgtcctttgagaagcccgagtacttcgtcagc
cgcggagagcaggtggcccgcattcccatcatccggcgcatcatcgacagtggcaagtcc
caagtctcctaccgcacacaggacaacacagcacatggcaaccgggactacatccccgtg
gagggcgagctgctattccatgctggggagacctggaaggagctgcaggtgaagctcctg
gagctgcaagagatggactccctccttcggggccgccagacccgccgcttccacatccac
cttagcaaccccaagttcggggcccgcctgggccagccccactcagccactgtcgtcatg
ggggacggagatgaactggaccggagcttaaccagccggactgtgtcatcaaccccgctc
ctccgcggtgacccagcggccccacagaaccccaatgccaaggctgccgggtcccggaag
atccacttcaactggctgccccctcctggcaagccgatgggatacaaggtgaagtactgg
atccagggcgactccgaggctgaagcccagatgatcgacagcaaggtgccctctgtggag
ctcaccaacctgtacccgtactgcgactacgagatgaaggtgtgtgcctacgggccgcag
ggcgagagcccatacagcccccttgtgacctgccgcacccaccaggaagtacccagcgag
ccggggcgcctggccttcaatgtagtctcctccaccgtgacccagctgagctgggccgag
ccggctgagaccaatggcgagatcacggcctacgaggtctgctatggcccagtcaacgag
gacaatcgacccatcgggcccatgaagaaggtgctggtggacagccccaagaggcggatg
ctgctcattgagaacctgcgggagtcccaaccatatcgttacacggtgaaggcgcgcaat
ggggcaggctgggggcctgagcgggaggccttcatcaacctggccacccagcccaagcgg
cccatgtccatccctatcatccccgacatccccatcgtggacgcccagagtggagaagac
tacaacagcttcctcatgtacagcgacgaggtgctgcgctccccgggcagcagccagagg
cccagcgtctccgacgacactgagcacctggtaaacgggcggatggacttcccgggcagc
gccaactccctgcacaggatgactgcagcaaacgccgcctacggcacccacttgagccca
cacctgccccaccgcgtgctgagcacgtcctccaccctcacgcgggactaccactcactg
acccgcacagagcactcacactcacactccgcaacgctgcccagggactactccactctc
acctccctctcctcccacggcctccctcccatctgggaagctgggaggagcaggcttccg
ttgtcctgggccctgggggcccggagtcgggctcgggtgaaggtgctgcccccctccggg
gactcacgagactctataatcctggcagggcagccagcagcgccctcttggggcccagac
tcccgcacggctgcgggtgtgcccgacacccccacccgtctggtgttctcggccctggga
cccacatccctgaaagtgagctggcaggagccacagtgtgagcgagcactgcagggctac
agtgtggagtaccagctgctgaacggtggtgagctgcatcggctcaacatccccaacccc
agccagacctcggtgctcgtggaggacctcctgcccaaccactcctacgtgttccgcgtg
cgtgcccagagccaggaggggtggggcccggagcgcgagggcgtcatcaccatcgagtcg
caggtgcacccacagagcccactctgccccctgccaggctccgccttcaccctgagcacc
cccagtgcgccgggccccctagtgttcacggccctgagccccgactcgctgcagctgagc
tgggagcggcctcggcggccccttggggacatcctcggctacctggtgacctgcgagata
gcccacggaggaggtgctgccccgccttccgggtaa

KEGG   Loxodonta africana (African savanna elephant): 100676335
Entry
100676335         CDS       T04351                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5
  KO
K06588  integrin beta 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05205  Proteoglycans in cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100676335 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100676335 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100676335 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100676335 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100676335 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100676335 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100676335 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100676335 (ITGB5)
   05414 Dilated cardiomyopathy
    100676335 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100676335 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100676335 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lav04515]
    100676335 (ITGB5)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100676335 (ITGB5)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin beta subunits
   100676335 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 100676335
NCBI-ProteinID: XP_010591201
LinkDB
Position
Unknown
AA seq 692 aa
MTPQEVAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRNLGTKLAEEM
RKLTSNFRLGFGSFVDKNISPFSYTAPRYQNNPCIGYKLFPNCVPSFGFRHLLPLTDRVD
SFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVYTTDDVPHIALDGK
LGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNF
TALIPGTTVEILHGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYP
GQRKCEGLKIGDTATFDVSVEARSCPGRQVEQRFTLRPVGFRDTLEVGVAYSCTCGCSAR
LEPDSTRCSGNGTYVCGLCECNPGYLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGEC
SCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCSGHGECHCGECRCHAGYIGDNCNCS
TGISSCQAKDGQICSDRGHCVCGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLH
SGKPAGNQTCHNYCKDEVITWVDTIVKDDQEAVLCFYKTAQDCVMMFTYTELPSGKTNLT
VLKEPECGSAPNAMTILLAVVGSILLIGIALLAIWKLLVTIHDRREFAKFQSERSRARYE
MASNPLYRKPISTHTVDFTFNKFNKSYNGTVD
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgacgccacaggaggtggcggtgaaccttcggccaggtgacaagactacctttcagctg
caggttcgacaagtggaggattatcctgtggacttgtactacctcatggacctctccctg
tccatgaaggatgacttggacaacatccgaaacctgggcaccaagctcgctgaggagatg
aggaagcttaccagcaatttccgattggggtttggctctttcgtagacaagaacatctcc
cctttctcctatacagcgccgaggtaccagaacaatccatgcattggttacaagttattt
ccaaactgcgtcccatcctttgggttccgccatctgctgcctcttacagacagagttgac
agcttcaacgaggaagtacggaaacagagggtgtcccggaaccgagatgccccagagggg
ggctttgacgcagtcctccaggcagctgtctgcaaggagaagattggttggcgaaaggat
gcactacacttgctggtgtacacaacagatgacgtgccacacatcgcactggacggaaaa
ctgggcggcctggtgcagccgcatgatggccagtgccacctgaatgaggccaacgaatat
accgcatccaaccagatggactatccatcccttgctttgcttggagagaagttagcagag
aacaacatcaacctcatctttgcagtgacaaaaaaccattatatgctctacaagaatttt
acagccctgatacctggaacaacagtggagattttacatggagactccaaaaatatcatt
cagctgattatcaatgcgtacaatagtattcggtctaaagtggagctgtcagtctgggat
cagcctgaggatctcaacctcttcttcactgctacctgccaagacggtgtatcctaccct
ggtcagaggaagtgtgaaggcctcaaaatcggggacacggcgacctttgatgtgtcagtg
gaggcccggagctgccccggcagacaggtggagcagaggttcaccctgcggcccgtgggg
ttccgggacaccctggaggtgggggtcgcctacagctgcacgtgtggctgcagcgcccgg
ctggagccagacagcaccagatgcagcggcaatgggacttacgtttgcggcctgtgcgag
tgcaaccccggctacctgggcaccaggtgcgagtgccaggaaggggagaaccagagcggg
taccagaacctgtgccgggaggccgaggggaagcccctgtgcagtgggcgcggggagtgc
agctgcaaccagtgctcctgctttgagagcgagttcgggaagatctacgggcctttctgt
gagtgcgacaacttctcctgtgccaggaacaagggagtcctctgctcaggccacggcgag
tgccactgtggagagtgcaggtgccacgcaggttacatcggggacaactgtaactgctcg
acgggcatcagctcgtgccaggccaaggacggccagatctgcagcgaccgtgggcactgc
gtctgtgggcagtgccagtgcacggagccgggagcctttggggagacgtgtgagaagtgc
ccgacctgccccgatgcctgcagtactaagagagattgtgtcgagtgcttgctgcttcac
tcagggaaaccagctggcaaccagacgtgccacaactattgcaaggatgaggtgatcacg
tgggtggacaccattgtgaaagatgaccaggaagctgtgctttgtttctacaaaactgcc
caagactgtgtcatgatgttcacctatacggagctccccagtgggaagaccaacctgacg
gtcctcaaggagccagagtgtggatctgcacccaacgccatgactatcctgctggccgtg
gttggcagtatcctcctgattgggattgcgctcctggccatctggaagctgctcgtcacc
atccacgaccgaagagagtttgcaaagttccagagtgagcgatccagggcccgctatgaa
atggcttcaaaccctctgtatagaaagcccatctccacacacaccgtggacttcaccttc
aacaagttcaacaagtcctacaatggcacggtggactga

DBGET integrated database retrieval system