KEGG   Loxodonta africana (African savanna elephant): 100660542
Entry
100660542         CDS       T04351                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8 isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05134  Legionellosis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100660542 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100660542 (CASP8)
   04215 Apoptosis - multiple species
    100660542 (CASP8)
   04217 Necroptosis
    100660542 (CASP8)
   04115 p53 signaling pathway
    100660542 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100660542 (CASP8)
   04621 NOD-like receptor signaling pathway
    100660542 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    100660542 (CASP8)
   04625 C-type lectin receptor signaling pathway
    100660542 (CASP8)
   04657 IL-17 signaling pathway
    100660542 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660542 (CASP8)
   05203 Viral carcinogenesis
    100660542 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660542 (CASP8)
   05016 Huntington disease
    100660542 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    100660542 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100660542 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100660542 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100660542 (CASP8)
   05134 Legionellosis
    100660542 (CASP8)
   05152 Tuberculosis
    100660542 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100660542 (CASP8)
   05161 Hepatitis B
    100660542 (CASP8)
   05160 Hepatitis C
    100660542 (CASP8)
   05164 Influenza A
    100660542 (CASP8)
   05162 Measles
    100660542 (CASP8)
   05168 Herpes simplex virus 1 infection
    100660542 (CASP8)
   05163 Human cytomegalovirus infection
    100660542 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100660542 (CASP8)
   05169 Epstein-Barr virus infection
    100660542 (CASP8)
   05165 Human papillomavirus infection
    100660542 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100660542 (CASP8)
   05142 Chagas disease
    100660542 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100660542 (CASP8)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100660542 (CASP8)
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C14: caspase family
   100660542 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 100660542
NCBI-ProteinID: XP_023398131
LinkDB
Position
Unknown
AA seq 478 aa
MDFNSLLFNIGEQLDSDKLASLKFLSLDHIPQRKQEHIKDPLAFFRALQEKRMLEENNQS
FLKELLFQIQSLDLLTRYLGVSKQEMERELQIPGKAQVSAYRVMLFQIFEDVNKEELKSF
KFLLRKEIPKCKLDDDMTLLDIFIEMEKRVILGERNLETLKRICGRINKSLLLKINDYED
LSREERKSLGRSSDGFSNEEDLVGELAISDSPRELESESQVSDKVYRMKSKPRGYCLIFN
NYDFTVARKDVQKLYNIKDRNGTNLDAEALEKTFKDLHFEVVHFKDHTAKKICEVLKSYQ
NEDHSNKDCFICCILSHGDKGIIYGTDGQEASIYELTSYFTGLKCPSLAGKPKIFFIQAC
QGSNYQKGIAIETDSEQQEACLDMASSPKSYIPDEADFLLGMATVNNCVSYRSPMEGTWY
IQSLCESLRERCPRGDDILTILTEVNYEVSSKDDKKNMGKQMPQPTFTLRKKLYFPLN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggatttcaacagccttctgtttaatattggcgaacaactggacagtgataaactggcc
tctctaaaattccttagcctggaccacatcccacaaaggaaacaagaacacattaaggat
cccttggcattcttcagggcactccaggaaaagagaatgttggaggagaacaaccagtcc
ttcttgaaggagctgcttttccaaattcaaagtctagacctactgaccaggtaccttggt
gtcagtaagcaggagatggagagagagcttcagataccaggcaaggcccaggtttctgcc
tacagggtcatgctttttcagattttcgaagatgtgaacaaagaggaattaaagtccttt
aagtttcttttgagaaaggagattcccaaatgtaaactggatgatgacatgaccttgctg
gatattttcatagagatggagaagagggtcatcctgggggaaagaaacttagaaaccctg
aaaagaatctgtggccgaatcaataagagcctgctgttgaaaatcaatgattatgaagac
ttaagcagagaggaaagaaagagccttggaagaagttcagatggattttcaaatgaggag
gacttggtcggagagctggctatctctgactctccaagagaactggaaagtgagtcacag
gtatcggacaaagtttaccgaatgaaaagcaaacctcggggatactgtttgatcttcaac
aattatgattttacagtagcacggaaggatgtgcagaaactttacaacattaaggataga
aacggaacaaacttggatgcagaggctttggaaaagacctttaaggatcttcactttgag
gtagtacatttcaaagaccacacagcaaagaagatctgtgaagttctgaaatcctaccaa
aatgaggaccatagtaacaaagactgcttcatctgctgcatcctctcccatggagacaag
ggcatcatctatggcactgatgggcaggaggcttccatctatgaactgacctcttacttc
actggtttgaagtgcccttcccttgcaggcaaacccaaaatcttttttattcaagcttgc
caagggagtaactaccagaaaggtatagccattgaaaccgactcagagcagcaggaagcc
tgtttagacatggcatcatctccgaagagctatattccagatgaggctgacttcctgctg
gggatggccactgtgaataactgtgtttcctaccgaagccccatggagggaacctggtat
atccagtcactttgcgagagcctgagagaaagatgtcctcgaggcgatgatattctcacc
atcctgacagaagtaaactatgaagtgagcagcaaggatgacaagaaaaacatggggaaa
cagatgccacaacctacgttcacactgagaaaaaaactctattttcctcttaattga

KEGG   Loxodonta africana (African savanna elephant): 100663575
Entry
100663575         CDS       T04351                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05134  Legionellosis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100663575
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100663575
   04215 Apoptosis - multiple species
    100663575
   04217 Necroptosis
    100663575
   04115 p53 signaling pathway
    100663575
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100663575
   04621 NOD-like receptor signaling pathway
    100663575
   04622 RIG-I-like receptor signaling pathway
    100663575
   04625 C-type lectin receptor signaling pathway
    100663575
   04657 IL-17 signaling pathway
    100663575
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663575
   05203 Viral carcinogenesis
    100663575
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663575
   05016 Huntington disease
    100663575
   05022 Pathways of neurodegeneration - multiple diseases
    100663575
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100663575
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100663575
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100663575
   05134 Legionellosis
    100663575
   05152 Tuberculosis
    100663575
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100663575
   05161 Hepatitis B
    100663575
   05160 Hepatitis C
    100663575
   05164 Influenza A
    100663575
   05162 Measles
    100663575
   05168 Herpes simplex virus 1 infection
    100663575
   05163 Human cytomegalovirus infection
    100663575
   05167 Kaposi sarcoma-associated herpesvirus infection
    100663575
   05169 Epstein-Barr virus infection
    100663575
   05165 Human papillomavirus infection
    100663575
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100663575
   05142 Chagas disease
    100663575
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100663575
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100663575
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C14: caspase family
   100663575
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 100663575
NCBI-ProteinID: XP_003405985
LinkDB
Position
Unknown
AA seq 440 aa
MEYFKKCLFTIGEQLDSEELASLKFLCLEHIPQKSQEHIKTGLMLFEKLQDKGMLEENNL
SFLKELLFRIQRLDLLANYLKVSQEEMERELQVPGKTQIFAYRLMLFQISQDITKEDLDS
FKFFLSRKIPRSRLKDNVTFLDILIEMERKDILGERKLDTLKNICDQINKNLVKIIEDYE
NLEEEAAVYRMDRKHRGHCVIVNNHNFTTQAARPGTHRDAESLKCVFQWLGFAVRVYDDV
TKADLEKALQEYKSHPDHVDGDCFVCCILTHGNLGAVYSSDGALIPIQEITSHFTAQQCP
GLAHKPKLFFIQACQGDEIQPSVSIEADALNPEKEPFSPREGSLQDSIPVEADFLLGLAT
VPGYVSFRHPEKGSWYIQSLCNHLKDLVPRHEDILSILTAVNNDVSRQADKDGTKKQMPQ
PAFTLRKKLIFPVPQETLSL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggagtattttaaaaaatgtctctttactatcggggagcaactggacagtgaagagctg
gcctccctgaaattcctgtgcctggaacatatcccacaaaagagccaggaacacatcaag
acaggcttgatgttatttgagaaactccaagataagggaatgttggaggagaacaatctg
tccttcttgaaagaactgcttttccgcattcaaagactagatctgttggccaattacctg
aaggtcagccaagaggagatggagagggagcttcaagtacctgggaagactcagattttt
gcctacaggctcatgctttttcagatttcacaagatataactaaagaagacttggattct
ttcaagtttttcttgagtcggaaaattcccagatctagactaaaggataacgtgaccttc
ctggatatactcattgagatggagagaaaggacatattgggggaaagaaaactggatacc
ctgaaaaatatttgtgaccaaatcaacaaaaacctagtgaagataatcgaagactatgaa
aacctggaggaggaggcagctgtgtacaggatggatcggaaacacagaggtcactgtgtc
attgtcaacaatcacaactttaccacacaggcagccagaccagggactcatagagatgct
gagagtctgaaatgcgtgtttcagtggcttgggtttgcagtacgggtatacgatgatgtg
actaaagcagacctggagaaggctctgcaggaatataagagtcatccagaccacgttgac
ggggactgcttcgtgtgctgtatcctgacccatgggaaccttggagctgtttactcttca
gacggggccctcattcccattcaggagatcacatctcacttcacagcccagcagtgccct
ggtctggctcacaaacccaaactctttttcatccaagcctgtcaaggtgatgagatacaa
ccttccgtatccattgaagcagatgctctgaatcctgagaaagaacccttttcccccagg
gaggggagtctccaagacagcattcctgttgaggctgatttcctgcttggcttggccact
gtcccaggctatgtatcctttcgacacccggagaaaggcagctggtatattcagtctctg
tgtaatcatctgaaggacttggtcccaagacatgaagacatcttatctatcctcactgct
gtcaacaatgatgtgagccggcaagcagacaaagatgggacaaagaaacagatgccccag
ccagctttcacactacggaagaaactaatatttcctgtgccacaggaaacactttcctta
tag

DBGET integrated database retrieval system