KEGG   Loxodonta africana (African savanna elephant): 100660695
Entry
100660695         CDS       T04351                                 

Gene name
MED1
Definition
(RefSeq) mediator of RNA polymerase II transcription subunit 1 isoform X1
  KO
K15144  mediator of RNA polymerase II transcription subunit 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100660695 (MED1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100660695 (MED1)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Middle
     100660695 (MED1)
SSDB
Motif
Pfam: Med1
Other DBs
NCBI-GeneID: 100660695
NCBI-ProteinID: XP_003414738
LinkDB
Position
Unknown
AA seq 1580 aa
MKAQGEAEESEKLNKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVS
CLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQL
CDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSL
EQDLSKMAIMYWKATNASPLDKILHGSVGYLTPRSGGHLMNLKYYASPSDLLDDKTTSPI
ILHENIVPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLP
ACFFLKFPQPIPVSRAFVQKLQNCTGIPLFEAQPTYVPLYELITQFELSKDPDPIPLNHN
MRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTL
IGSCVKRTILKEDCPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLY
KGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNL
PPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQ
NPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTL
YGSSPLERQNSSSGSPRMEMCSGSNKTKKKKSSRLPPDKPKHQTEDDFQRELFSMDVDSQ
NPIFDVNMTADALDTPHITPAPSQCSTPPTTYPQPIPHPQPSIQRMVRLSSSDSIGPDVT
DILSDIAEEASKLPSTSDDCPPIGTPVRDSSSSGHSQSALFDPDVFQTNNNENPYTDPAD
LIADAAGSPSSDSPTNHFFPDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFAS
QALNTLGVPMLGGDNGETKFKGNSQADTVDFSIITVAGKALGPADIMEHHSGSQSPLLTT
GDLGKEKTQKRVKEGNGTSNSSLSGPGLDSKPGKRSRTPSNDSKSKDKPPKRKKADTEGK
SPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVSKSSSH
SQYTSSGSVSSSGSKSHHSHSSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSG
SSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPP
GASDKLASPMKPVPGTPPSSKAKSPISSGSGGSHISGTSSSSGMKSSGLGSSGSLSQKTP
PSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPG
GEDQMDGQMGVSTNSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGGSVDSSKKTSES
KNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTP
KHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHK
KEKKKVKDKDRDRDRDKDRDKKKSHSIKPENWSKSPISSDQSLSLTSNTILSADRPSRLS
PDFMIGEEDDDLMDVALIGN
NT seq 4743 nt   +upstreamnt  +downstreamnt
atgaaggctcagggggaagccgaggagtcagaaaagctgaataagatgagttctctcttg
gaacgactccatgcaaaatttaaccaaaatagaccttggagtgaaaccattaagcttgtg
cgtcaagtcatggagaaaagagttgtgatgagttctggagggcaccaacatttggtcagc
tgtttggagacattgcagaaggctctcaaagtaacgtctttaccagcaatgactgaccgt
ttggagtctatagcaagacagaatggactgggctctcatctcagtgccagtggcactgaa
tgttacatcacgtcagatatgttctatgtggaagtgcagttagatcctgcaggacagctt
tgtgatgtaaaagtggcccaccatggggagaatcctgtgagctgcccagagcttgtgcag
cagttaagggaaaaaaattttgatgaattctctaagcatcttaagggtcttgttaatctg
tataacctaccaggggacaacaaactgaagactaaaatgtacttggctctccaatcctta
gaacaggatctatctaaaatggcaattatgtactggaaagcaaccaatgctagtcccttg
gataagattcttcatggaagtgttggctatctcactccaaggagtgggggtcatttaatg
aacttgaagtactatgcctctccctctgacctgctggatgataagactacatctcccatc
attttgcatgagaatattgttcctcgatctttgggcatgaatgcatcggtgacaattgaa
ggaacatctgctatgtacaaactcccaattgcaccgttaattatggggtcgcatccagtt
gacaacaagtggaccccttccttctcctcaatcaccagtgctaacagtgttgatcttcct
gcctgtttcttcttgaaatttccccagccaatcccagtatctagagcatttgttcagaaa
cttcagaattgcacaggaattccattgtttgaagctcaaccaacttatgtacctctgtat
gaactgatcactcagtttgagctgtcaaaggacccagaccccatacctttgaatcacaac
atgcggttttatgcggctcttccaggccagcagcattgctatttcctcaacaaggatgct
cctcttccagatggccgaagtctacagggaacccttgttagcaaaatcacttttcagcac
cctggccgggttcctcttattttaaatctgatcagacaccaagtggcctataatacccta
attggaagctgtgtcaaaagaactattctgaaagaagattgtcctggactccttcaattt
gaggtgtgtcccctttcagagtcccgtttcagcgtgtcttttcagcaccctgtgaatgac
tccctggtgtgtgtggtaatggatgtgcaggactcaacacatgtgagctgtaaactctac
aaggggctgtcagatgcacttatctgcacagatgacttcattgccaaagttgttcaaaga
tgtatgtccatccctgtgacgatgagggctattcggaggaaagctgaaaccattcaggcc
gacaccccagccctgtccctcattgcagagacagttgaagacatggtgaaaaagaacctg
cccccggctagcagcccagggtatggcatgaccacaggcaacaacccaatgagtggtacc
actacaccaaccaacacctttccggggggtcccattaccaccttgtttaatatgagcatg
agcatcaaagatcggcatgagtcggtgggccatggggaggacttcagcaaggtgtctcag
aacccaattcttaccagtttgttgcaaatcacagggaacggggggtctaccattggctcg
agtccgacccctcctcatcacacgccgccacctgtctcctcgatggccggcaacaccaag
aaccacccgatgctcatgaaccttcttaaagataatcctgcccaggatttctcaaccctt
tatggaagcagccctttagaaaggcagaactcctcttctggctcaccccggatggaaatg
tgttcggggagcaacaagacgaagaagaagaagtcatcaagattaccgcctgacaaaccg
aagcaccagactgaagatgactttcagagggagctattttcaatggatgttgactcacag
aaccctatctttgatgtcaacatgacagctgacgctctggatactccacatatcactcca
gctccaagccagtgtagcactcccccaacaacttacccacaaccaatacctcacccccag
cccagtattcagaggatggtccgactatccagttcagacagcattggcccagatgtaact
gatatcctttcagacattgcagaagaagcctctaagcttcccagcactagtgatgattgc
ccacccattggcacccctgttcgagattcttcaagctctgggcattctcagagtgccctc
tttgaccctgatgtctttcaaaccaataataatgaaaatccatacactgatccagctgac
cttattgcagatgctgctggaagccccagtagtgactctcctaccaatcatttttttcct
gatggagtagatttcaatcctgatttattgaacagccaaagccaaagtggttttggagaa
gaatactttgatgaaagcagccaaagtggggataatgatgatttcaaaggatttgcatcc
caggcattaaatactttgggggtgccaatgcttggaggtgataatggagagactaagttt
aaaggcaatagccaagctgacacagttgatttcagtattataacagtggctggtaaggct
ttgggtcctgcagatattatggagcatcacagtggtagccagagtcctttattgaccact
ggggacttaggcaaagaaaagactcaaaagagggtaaaggaaggcaatggtaccagtaac
agtagtctgtcagggccaggattagacagcaaaccagggaaacgcagtcggaccccttct
aatgacagcaaaagcaaagataagcctccaaagcggaagaaggcagacactgaggggaag
tctccatctcacagttcctctaaccgacctttcaccccacctaccagtacaggtggatcc
aaatctccaggcagttcaggaagatctcagactcccccaggtgttgctacaccacccatt
cccaaaattactattcagattcccaagggaacagtgatggtgagcaagtcctcctctcac
agtcagtacaccagcagtggttctgtgtcttcctcaggcagtaaaagccatcatagtcat
tcttcttcctcttcctcgtcttctgcttccacttcaggcaagatgaaaagcagtaaatca
gaaggttcatcaagttccaagttaagtagcagtatgtattctagccaagggtcttctgga
tctagccagtccaaaaattcatcccagtctggggggaagccaggctcctctcccattacc
aagcatggactgagcagtggctccagtagcaccaagatgaaacctcaagggaagccatcg
tcacttatgaatccttctctaagtaaaccaaacatatccccttctcattcaaggccacct
ggagcctctgataagcttgcctctccaatgaagcctgttccggggactcccccatcctct
aaagccaagtcccctatcagttcaggttctggtggttctcatatatctggaactagttca
agctctggcatgaaatcttcagggttaggatcctcagggtcattgtcccagaaaacgccc
ccatcatctaattcttgtacagcatcttcctcttccttttcctcaagtggttcttccatg
tcatcctctcagaaccagcatgggagttccaaagggaaatctcccagcagaaataagaag
ccgtccttaacggcagtcatagataaactgaagcatggagttgtcaccagtggcccaggg
ggggaggaccagatggacggccagatgggggtgagcacgaattctagccatcccatgtcc
tccaagcataacatgtcaggaggagagttccagggcaagcgtgagaaaagtgataaagac
aaatcaaaggtttccacctcggggggctcagtggattcttccaagaagacttcagagtca
aaaaatgtggggagcacaggtgtggcaaagattatcatcagcaagcacgatggaggatcc
cccagcattaaagccaaagtgactttgcagaaacctggggaaagtagtggagaagggctc
aggcctcagatggcctcttccaaaaactatggctctccactcatcagtggttccactcca
aagcatgagcgtggctctcccagccatagtaagtcaccagcatataccccccagaatctg
gacagtgaaagtgagtcaggctcctccatagcagaaaaatcttatcagaacagtcccagc
tcagatgatggtatccgaccacttccagaatacagcacagagaagcataagaagcacaaa
aaagaaaagaagaaagtaaaagacaaagatagggaccgggaccgggataaagaccgagac
aagaaaaaatctcatagcattaagccagagaattggtctaaatcgcccatctcttcagac
cagtccttgtctttgacaagtaacacaatcttatctgcagacagaccctcaaggctcagc
cctgactttatgattggggaggaagatgatgatcttatggatgtggccctgattggcaat
tag

KEGG   Loxodonta africana (African savanna elephant): 100668174
Entry
100668174         CDS       T04351                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3 isoform X1
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04915  Estrogen signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05200  Pathways in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100668174 (NCOA3)
   04919 Thyroid hormone signaling pathway
    100668174 (NCOA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100668174 (NCOA3)
  09162 Cancer: specific types
   05224 Breast cancer
    100668174 (NCOA3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100668174 (NCOA3)
Enzymes [BR:lav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100668174 (NCOA3)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100668174 (NCOA3)
SSDB
Motif
Pfam: NCOA_u2 DUF4927 SRC-1 PAS_11 Nuc_rec_co-act DUF1518 PAS PAS_3 PAS_9 HLH PAS_4 PAS_2 SUIM_assoc
Other DBs
NCBI-GeneID: 100668174
NCBI-ProteinID: XP_010590070
LinkDB
Position
Unknown
AA seq 1427 aa
MSGLGENSLDPLATDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVAWTNETQRQKSHTFNCRMLMKTPQDILEDISTSPEVRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPANPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPLGQGIRPPVAGCNNSVGGMSMSPNQGLQMLSSRTYGL
ADPTATGQMSGARYGGSSNIASLNPGPGMQSPSSYQNNNYGLNMNSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVPGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLNDKESK
ENNVEGSENQRGPLESKGHKKLLQLLTYSSDDRGHSSLTNSPLDSSCKDSSLSVTSPSGV
SSSTSGGVSSTSNMHGSLLQKKHRILHKLLQNGNSPAEVAKITAEATGRDTSSTAPCGEG
NVKQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPKVEGIDSKMSQCGSSTIPSSSQE
KDSKIKTETNEEGPGDLDHLDAILGDLTSSDFYNNSISTNGGSNLGTKQQMFQGTNSLGK
ERTGLRSPQSVQPIRPPYNRAVSLNSPVPVGSSPPVKNISAFPMLPKQPVSGGNPRMMDS
QENYGSNMAGPNRNVTVTQTASSGDWGLPNSKASRMEPMSSNSVGRPGADFNATLPRPVV
AGSMPTLPVRSSGAPGMRPGLQQQQQQQQQQQQQQMLQMRSGEIPMGMGVNPYSQAAPSN
QPGSWPDGMLSVEQGPHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTD
ATGLEEIDRALGIPELVNQGQALEPKQEAFQGQEAAVMMDQKAAALYGQTYPGQGPPMQG
GFTLQGQSSSFNSVMSQMSQQGSFPLQGVHPRASIVRPRTSTPRQLRMQLQQRLQGQQFL
NQSRQALEMKVENPTTAGAAMMRPVMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVA
MMMQHQQHQQQQQQQQQQTTQAFSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGM
GQQPDPAFGRVSSPPSAMMSSRMGPSQNPMMQHPQTVPMYQSSEMKGWPSGNLARNSSFS
QQQFAHQGNPGAYSMVHMNGSSGHMGQMNMNSMPMSGMPMGPDQKYC
NT seq 4284 nt   +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttggatccgttggctactgattcacgaaaacgcaaa
ttgccatgcgataccccaggacaaggtcttacctgcagtggtgaaaagtggagaagggag
caggagagtaaatatattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctatttccagtgacgatgatgttcagaaagctgat
gtgtcttctacaggacagggagttattgataaagactccttaggaccacttttacttcag
gcactggatggtttcctgtttgtcgtgaatcgagacggaaacattgtatttgtgtcagaa
aatgtcacacaatacctgcaatataagcaagaggacctggttaatacaagtgtctacaat
atcttacatgaagaagacagaaaggattttcttaaaaacttgccgaaatctacagttaat
ggagtcgcctggacaaatgagacacagagacagaagagccatacgtttaattgccgtatg
ttgatgaaaacaccacaggatattctggaagacataagcaccagccctgaagtacgccag
agatatgaaacaatgcagtgctttgccctgtcccagccacgagctatgatggaggaaggg
gaagatttgcaatcctgtatgatctgtgtggcacgccgcattactacaggagaaagagcg
tttccagcaaatcccgaaagcttcattactaggcatgatctttcaggcaaagttgtcaat
atagatacaaattctctgagatcatccatgaggcctggctttgaagatataatccgaaga
tgtattcagagattttttagtcttaatgatggacagtcatggtcccagaaacgtcattat
caagaagcttacattcatggccatgcagaaaccccagtatatcgattctccttggctgat
ggaactatagtaactgcacaaactaagagcaaactcttccgaaaccctgtaacaaatgat
cgtcatggctttgtctcaacccactttcttcaaagagaacagaatgggtatagaccaaac
ccaaatcctcttggacaaggcattagacctcctgtagctgggtgcaacaattcagtaggt
ggcatgagcatgtcaccaaaccaaggcttacagatgctgagcagcaggacctatggcttg
gcagaccctactgccacagggcagatgagtggagctagatatgggggctccagtaacatt
gcttcactgaaccctgggccgggcatgcagtcaccatcttcctaccagaacaacaactat
ggtctcaacatgaatagtcccccgcacgggagtcctggccttggctccaaccagcaaaat
atcatgatttctcctcgtaatcgtgggagtccaaagatggcctcacaccagttttctcct
gttccaggtgtgcactcgcccatgggatcttctggcaatactgggagccacagcttttcc
agcagctctctcagtgccctgcaggctatcagtgagggtgttgggacttctcttctgtct
actctgtcttccccaggccccaaattggataactctcccaatatgaatataacccagcca
agtaaagtgaacagccaggattccaagagtcctctaggcttatattgtgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagggatcacctcaatgacaaagaaagtaaa
gagaacaatgtagaagggtcagagaatcagaggggtcctctggaaagcaaaggtcataaa
aaattgctgcagttacttacctattcttcagatgaccgaggtcattcctccttgaccaac
tctcccctggattcgagttgtaaagactcatcccttagtgtcaccagcccctctggagtc
tcctcttctacttctggaggcgtgtcctccacgtccaatatgcatgggtcactgttgcaa
aagaaacacagaattttgcacaagttgctgcagaatgggaattcgccagctgaagtagcc
aagataacagcagaagccaccgggagagacaccagtagtacagctccttgtggagaagga
aatgtcaagcaggagcagctaagtcctaagaagaaggaaaataatgcacttcttagatac
ctgctagatagggatgatcctagtgacaccctctctaaagagctacagcccaaagtggaa
ggcattgatagtaaaatgagtcagtgtggcagctccaccattcctagttcgagtcaagaa
aaagactctaaaatcaagacagaaacaaatgaagagggacctggagacttggatcatcta
gatgctattcttggtgatctgacgagttctgacttttacaataattccatatccacgaat
ggtggtagtaatctgggaaccaagcagcagatgtttcaaggaactaattctctcggtaag
gaaagaacaggtttgagaagtccacagtctgtgcagcccattcgtcctccttataatcga
gcagtgtctctaaatagcccggtgcctgtcggctcaagccctccagtgaagaatatcagt
gctttccccatgttaccaaagcaacccgtgtcgggtgggaatccaagaatgatggatagt
caagaaaattatggctcaaatatggctggaccaaaccggaatgtgactgtgactcaaact
gcttcctcaggagactggggcttaccaaactcaaaggctagcagaatggagcctatgagt
tcaaactccgtggggagaccaggagcagattttaacgctactttgcccagacctgtggtg
gctggctccatgcccaccctgcctgttcggtccagtggtgcaccaggcatgagaccaggg
ttgcagcaacagcagcaacagcagcagcagcaacagcaacagcagatgcttcaaatgagg
tctggtgagattcccatgggaatgggggtcaatccttatagccaagcagcaccatctaac
caaccaggttcctggccagatggcatgttatctgtggaacaaggccctcatgggactcaa
aataggccacttcttaggaattctctggatgatctccttgggccaccatctaacctagaa
ggccagagtgatgaaagagcattgctggaccagctgcacacactcctaagcaacacagat
gctacaggcctggaagaaattgacagagctttgggcatccctgaacttgtaaatcaagga
caagctttggagcccaaacaggaagcttttcaaggccaggaagcagcagtcatgatggat
cagaaggcggcagcattgtatgggcagacgtacccaggacaggggcccccaatgcaagga
ggctttactcttcagggacagtcatcgtcctttaactctgtgatgagtcagatgagccag
caaggcagttttcctctccagggagtgcatccgagggccagcatcgtgaggccgcggacg
agcacccccaggcagctgcggatgcaacttcagcagaggctgcagggccagcagtttttg
aatcagagccgtcaggcactggaaatgaaagtggaaaatcccactactgcgggggctgcg
atgatgaggcccgtgatgcagccacaggtgaactcacagcagggctttctcaacgcccag
atggtcgcccagcggagcagagagctgctcagtcatcacttccgacagcagagggtggcg
atgatgatgcagcaccagcagcaccagcagcagcagcagcagcagcagcagcagacgacc
caggcctttagcccgccccctaatgtgactgcctcccccagcatggatggcgttttggca
ggacctgtgatgccccaggctccaccacagcagtttccatacccaccaaattacggaatg
ggccaacaacctgatccagcctttggtcgagtgtctagtcctcccagcgcaatgatgtca
tcaagaatgggtccctcccagaatcccatgatgcagcaccctcagactgtaccaatgtat
cagtcctccgaaatgaagggctggccatcggggaacctggccaggaacagctccttttcc
cagcagcagtttgcccaccaggggaatcctggggcttatagtatggtgcacatgaatggc
agcagtggtcacatgggacagatgaatatgaactcaatgcccatgtctggcatgcccatg
ggtcctgatcagaaatattgctga

KEGG   Loxodonta africana (African savanna elephant): 100669672
Entry
100669672         CDS       T04351                                 

Gene name
CARM1
Definition
(RefSeq) histone-arginine methyltransferase CARM1 isoform X1
  KO
K05931  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100669672 (CARM1)
Enzymes [BR:lav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     100669672 (CARM1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     100669672 (CARM1)
SSDB
Motif
Pfam: CARM1 PrmA Methyltransf_25 MTS Methyltransf_9 Methyltransf_11 PRMT5 Methyltransf_31 Methyltransf_23 Methyltransf_18 Methyltransf_12 TehB Met_10 CMAS Cons_hypoth95 PRMT5_C Methyltransf_32
Other DBs
NCBI-GeneID: 100669672
NCBI-ProteinID: XP_023408188
LinkDB
Position
Unknown
AA seq 556 aa
MCPWWKCVGTGPRLKSGLEVRDEDVCVFKCAVSRETECSRVGKQSFIITLGCNSVLIQFA
TPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTY
QRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLT
DRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDV
HLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKS
VKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPL
THWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNP
FFRYTGTTPSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIAGGSSVGH
NNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSSGGGSSAHYAVNSQFTMGGPAIS
MASPMSIPTNTMHYGS
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtgcccctggtggaaatgtgtagggacagggccgaggctgaagtccggcttggaagta
agagatgaagacgtgtgtgtgtttaagtgtgcagtgtcccgagagacggagtgcagccgt
gtgggcaagcagtccttcatcatcaccctgggctgcaacagcgtcctcatccagtttgcc
acgccaaatgatttctgttccttctacaacatcctgaaaacctgccggggccacaccttg
gagcggtctgtgttcagcgagcggacggaggagtcctctgccgtgcagtacttccagttt
tatggctacctgtcccagcagcagaacatgatgcaggactacgtgcggacaggcacctac
cagcgtgcaatcctgcagaaccacaccgacttcaaggacaagatcgttcttgacgttggc
tgtggttctgggatcctctcgtttttcgcggcccaggctggagcaaggaagatctacgcg
gtagaggccagcaccatggcccagcacgcggaggtcttggtgaagagcaacaacctgact
gaccgcatcgtagtcatccctgggaaggtggaggaggtctccctccccgagcaggtggac
atcatcatctcggagcccatgggttacatgctcttcaacgagcgcatgctggagagctac
ctccacgccaagaagtacctgaagcccagcggaaacatgttccccaccattggtgatgtc
caccttgcgccctttacggatgaacagctctacatggagcagttcaccaaggccaacttc
tggtaccagccatccttccatggagtggatctgtcagccctccgaggtgctgctgtggat
gagtatttccggcagcctgtggtggacacatttgacatccggatcctgatggccaagtcc
gtcaagtacacagtgaacttcttagaagccaaagaaggagatttgcacaggatagaaatc
ccattcaaattccacatgctgcattcagggctggttcacggtctggccttctggtttgac
gttgctttcatcggctccataatgaccgtgtggctgtccacggccccaacggagcccctg
acccactggtaccaggtacggtgcctgttccagtcaccactgttcgccaaggccggggac
acgctctcagggacatgtctgcttattgccaacaaaagacagagctatgacatcagtatt
gtggcccaggtagaccagacgggctccaaatccagtaacctcctggatctgaaaaacccc
ttcttcagatacacaggcacgacaccctcgcccccacctggctcccactacacgtctccc
tcagagaacatgtggaacacaggcagcacctacaacctcagcagtgggatggctgtggct
gggatgccgactgcctatgatctgagcagtgttattgctggtggctccagcgtgggccac
aacaacctgattcctttagccaacacggggattgtcaatcacacccactcccggatgggc
tccataatgagcacggggattgtccaagggtcctccggcgcccagggcagcagcggcggt
ggctcaagcgcccactacgcagtcaacagccagttcactatgggtggccccgccatctca
atggcctcgcccatgtccatccctaccaacaccatgcactacgggagctag

DBGET integrated database retrieval system