KEGG   Loxodonta africana (African savanna elephant): 100660747
Entry
100660747         CDS       T04351                                 

Gene name
RAPGEF4
Definition
(RefSeq) rap guanine nucleotide exchange factor 4
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04670  Leukocyte transendothelial migration
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100660747 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    100660747 (RAPGEF4)
   04024 cAMP signaling pathway
    100660747 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100660747 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    100660747 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100660747 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100660747 (RAPGEF4)
Membrane trafficking [BR:lav04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100660747 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF DEP cNMP_binding RasGEF_N
Other DBs
NCBI-GeneID: 100660747
NCBI-ProteinID: XP_023398615
LinkDB
Position
Unknown
AA seq 848 aa
MDMAITAFHPGPSGCRTPLIEPHVPLRPANTITKVPSEKILRAGKILRNVILSRAPHMIR
DRKYHLKTYRQCCVGTELVDWMMQQTQCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDK
YLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDD
LEIIYEELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVN
VVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEAN
TVRLKEHDQDVLVLEKVPAGNRASNQGNSQSQQKYTVMSGTPEKILEHFLETIRLEPALN
EATDSVLNDFVMMHCVFMPNTQLCPALVAHYHAQPSQGTEQEKMDYTLNNKKRVIRLVLQ
WAATYGDLLQEDDVAMAFLEEFYVSVSDDARMIAALKEQLPDLEKIVKQILEEAKAPQKK
HKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTIRVPVAASVKEVISAVADKL
GSGEGLIIVKMSSGGEKVLLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVG
TVGTFELMSSKDLAYQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEI
QFWVVTEICLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWE
KLPSKFKKFYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFTD
NLVNFEKMRMIANTARTVRYCRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMS
HRLEPRRP
NT seq 2547 nt   +upstreamnt  +downstreamnt
atggatatggctatcacggcattccaccctggaccttctggttgtaggacacctctcatt
gaacctcacgttcctcttcgtcctgctaacactattaccaaggtcccttcagagaagatc
ctcagggctggaaaaattttacgaaatgtcatcctctctcgagcacctcacatgattaga
gacagaaaataccacctgaagacatatagacaatgctgtgtgggaactgaattggtggac
tggatgatgcagcagactcagtgtgttcactcccggacccaagctgttggcatgtggcaa
gtcctgttagaagatggtgttctcaaccatgtggaccaggagcaccatttccaagacaaa
tatttattttatcgattcctggatgacgagcacgaggatgcccctttgcctactgaggag
gagaagaaggagtgtgatgaggaactccaggacaccatgctgctgctgtcgcagatgggc
cccgacgcccacatgaggatgatcctccgcaaaccacctggccaaaggacggtggatgac
ctagagattatctatgaagagctcctacacattaaagccttgtcccatctttctaccaca
gtgaaacgggagttagcaggtgttctcattttcgagtcccatgccaaaggaggaactgtg
ttgtttaaccagggagaagaaggtacctcctggtacattattctaaaaggatcagtgaat
gtagtcatttatggcaagggtgtggtctgcaccctgcacgagggagatgactttggcaaa
ttagcactagtcaacgatgcccctcgagctgcctctatcgtcttgcgagaagataattgt
catttcttaagagtagacaaggaggatttcaaccggatcctgagggacgtggaggcgaat
acagtcagacttaaagaacatgaccaagacgtcttggtgctggagaaggtcccagcaggg
aacagagcttctaatcaaggaaactcacagtctcagcaaaagtacactgtgatgtcagga
acacctgaaaaaattttagaacattttttagaaacaatacgccttgagccagctttaaat
gaagcaacagattctgttttaaatgattttgttatgatgcactgtgtttttatgccaaat
acccagctttgtccagccctagtggcccattaccacgcacagccttcccaaggtacggaa
caggagaagatggactataccctcaacaacaagaagcgagtcatccgcctggttctacag
tgggctgccacatatggagacctcctacaagaggatgacgtggcaatggctttcctggag
gagttttatgtgtctgtatcagatgatgcccggatgattgctgccctcaaggagcaactg
ccggacttggagaagattgtcaagcaaattttagaagaggcaaaagctccacaaaagaag
cacaaggttcttttacaacagttcaacacaggagatgagagagcccagaaacgccagcct
attcggggctctgatgaagtcctatttaaggtgtattgcatggaccacacctacacaacc
atccgggtgccagtggcagcctcagtgaaggaagtcatcagtgcagttgccgacaaactg
ggctctggagaaggcctgatcatagtcaagatgagttccggcggagagaaggtgctgctc
aaacctaatgatgtttcagtatttacgacactcaccattaacggacgcctgtttgcttgc
ccgcgagagcaattcgattcactgactcccttgccagaacaagaagggccaactgttgga
acagtgggaacttttgaactgatgagctccaaagatttagcataccagatgacgatttat
gactgggaactcttcaactgtgtgcatgagctggagctaatctaccacacatttggaagg
cataattttaaaaagaccacagcaaacttggatttgttcctgaggagatttaatgaaatt
cagttttgggttgtcactgagatttgcctttgttcccagctcagcaagcgtgttcagctc
ttaaaaaaatttattaagatagcagcccactgtaaagagtacaaaaacctgaattccttt
tttgccatcgtcatgggactaagtaacgttgctgtgagccgcctggcactaacgtgggag
aaactgccaagcaagttcaagaagttctatgcagagtttgaaagtttaatggatccttca
agaaaccacagagcgtacaggttgacagtagctaaactggagcctcctctcatccccttc
atgcctttgctcattaaagatatgacatttactcatgaggggaacaagacgttcactgac
aatctagtaaactttgaaaaaatgcgcatgattgcaaatactgccagaacagtgagatac
tgcagaagccaacccttcaatcctgatgcagctcaagctaataagaaccatcaggatgtc
cggagttatgtacggcaattaaatgtgattgacaaccagagaactttatcacagatgtca
catagattagagcctcgtcggccatag

DBGET integrated database retrieval system