KEGG   Loxodonta africana (African savanna elephant): 100660760
Entry
100660760         CDS       T04351                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04080  Neuroactive ligand-receptor interaction
lav04151  PI3K-Akt signaling pathway
lav04630  JAK-STAT signaling pathway
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100660760 (GHR)
   04151 PI3K-Akt signaling pathway
    100660760 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100660760 (GHR)
   04060 Cytokine-cytokine receptor interaction
    100660760 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100660760 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lav04050]
    100660760 (GHR)
Cytokine receptors [BR:lav04050]
 Interleukin receptor families
  Prolactin receptor family
   100660760 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 100660760
NCBI-ProteinID: XP_010586423
LinkDB
Position
Unknown
AA seq 623 aa
MDLWQLLLTLALAGSSDAFSGTKGDAQLLTRSPWSLQRVNPGPGTNSSGKPKFTKCRSPE
LETFSCHWTNGVHQDLRSPGAVQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTS
IWIPYCIKLTDNGGTVDQKCFSVEEIVQPDPPISLNWTLLNISLTGIHADIQVKWEPPPN
ADVHKGWIVLEYELQYKDVNETQWKTMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNFEKY
GEFSEVLYVTLPQMSPFACEEDFRFPWLLIIIFGIFGLTVMLFVFIFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKPEFYNDDSWVEFIELDIDDPDEKAEGS
DTDRLLSNDPQKSLNILGAKDDDSGRTSCYEPDILETDFNVIDMCDGTSERLSAKLKGAD
LLCLDRESNSSQSTEAQRKQPGPLLTGGTESAHQAAHTQLSNPSSLANIDFYAQVSDITP
AGSVVLSPGQKLKAGISQCDMHPEVVLPRQANFIMDNAYFCEADAKKCIAVAPHIQVESH
VEPSFNQEDSYITTESLTTTAVRSEAAERAPSSEMPVPDYTSIHIIQSPQGLVLNATALP
LPDKEFLTSCGYVSTDQLNKIMP
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcgctggcaggctcaagcgatgctttttct
gggactaagggtgatgctcagctgctaaccagaagcccctggagtctgcaaagagttaat
ccaggcccagggacaaattcttctgggaagcctaaattcaccaagtgccgttcacccgaa
ctggagacattttcatgccactggaccaatggggttcatcaggatttaaggagcccagga
gccgtacagctattctatattagaaggagcactcaagaatggactcaagaatggaaagaa
tgtcctgattatgtctctgctggagaaaacagctgttactttaattcatcttatacctcc
atttggataccctactgtatcaaactaactgacaatggtggtacggtggatcaaaagtgt
ttctctgttgaggaaatagtgcaaccagaccctcccattagcctcaactggactttgctg
aacatcagtttaactgggattcatgcagatatccaagtgaaatgggaaccaccacccaat
gcagatgttcacaagggatggatagtcctggagtacgaacttcaatacaaagatgtaaat
gagacccaatggaaaacgatggaccctgtattgtcaacatcagttccggtgtactcgttg
agactggataaagaatatgaagtgcgtgtgagatccaggcaaagaaactttgaaaaatat
ggcgagttcagtgaggtgctctatgtaacacttcctcaaatgagcccatttgcatgtgaa
gaagatttccgttttccatggttgttaattattatctttggaatatttgggctaactgtg
atgctatttgtgttcatattttctaaacagcaaaggattaagatgctgattctgccccca
gttccagttccaaagattaaaggaattgatccagatcttctcaaggaaggaaaactagaa
gaagtgaacacaatcttagccattcatgacaactataaacctgaattctacaatgatgac
tcttgggttgagtttattgagctagacattgatgaccctgatgaaaaggctgaaggatca
gacacagacagacttctaagcaatgaccctcaaaaatctcttaatatccttggggcaaaa
gatgacgattctggacgtaccagctgttatgaacctgacattctggagactgatttcaat
gtcattgacatgtgtgatggtacctcagagcggctcagcgcaaagttaaagggagcagat
ctcttgtgccttgacagagaatcaaatagctcacagtctactgaggctcagaggaagcaa
ccaggaccacttcttactggtggaactgaatcagctcatcaagctgcccatactcagcta
agcaatccgagttcactggcaaacatcgacttttatgcccaggtaagcgacattacacca
gcagggagtgtggtcctttcgccaggccaaaaacttaaagcagggatatcccagtgtgac
atgcatccagaagtggtcttaccacgccaagccaacttcatcatggacaacgcctacttc
tgtgaggcagatgccaaaaagtgcatcgccgtggcccctcacatccaggtcgaatcacat
gtggagccaagctttaaccaggaagacagttacatcaccacagaaagccttaccactact
gctgtgagatcagaggcagcagaacgagcacccagctccgagatgcctgtcccagactat
acctccatccatataatacagtctccacagggcctcgtcctcaacgcgactgccttgccc
ttgcctgacaaagagtttctcacatcatgtggctacgtgagcacagaccaactgaacaaa
atcatgccgtag

DBGET integrated database retrieval system