KEGG   Loxodonta africana (African savanna elephant): 100660846
Entry
100660846         CDS       T04351                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01523  Antifolate resistance
lav04060  Cytokine-cytokine receptor interaction
lav04061  Viral protein interaction with cytokine and cytokine receptor
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04640  Hematopoietic cell lineage
lav04657  IL-17 signaling pathway
lav04659  Th17 cell differentiation
lav04668  TNF signaling pathway
lav04672  Intestinal immune network for IgA production
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05134  Legionellosis
lav05135  Yersinia infection
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05144  Malaria
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
lav05332  Graft-versus-host disease
lav05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100660846 (IL6)
   04668 TNF signaling pathway
    100660846 (IL6)
   04066 HIF-1 signaling pathway
    100660846 (IL6)
   04068 FoxO signaling pathway
    100660846 (IL6)
   04151 PI3K-Akt signaling pathway
    100660846 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100660846 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100660846 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100660846 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100660846 (IL6)
   04620 Toll-like receptor signaling pathway
    100660846 (IL6)
   04621 NOD-like receptor signaling pathway
    100660846 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100660846 (IL6)
   04625 C-type lectin receptor signaling pathway
    100660846 (IL6)
   04659 Th17 cell differentiation
    100660846 (IL6)
   04657 IL-17 signaling pathway
    100660846 (IL6)
   04672 Intestinal immune network for IgA production
    100660846 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660846 (IL6)
   05202 Transcriptional misregulation in cancer
    100660846 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100660846 (IL6)
   05321 Inflammatory bowel disease
    100660846 (IL6)
   05332 Graft-versus-host disease
    100660846 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660846 (IL6)
   05020 Prion disease
    100660846 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100660846 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100660846 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100660846 (IL6)
   04931 Insulin resistance
    100660846 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100660846 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100660846 (IL6)
   05135 Yersinia infection
    100660846 (IL6)
   05133 Pertussis
    100660846 (IL6)
   05134 Legionellosis
    100660846 (IL6)
   05152 Tuberculosis
    100660846 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100660846 (IL6)
   05161 Hepatitis B
    100660846 (IL6)
   05171 Coronavirus disease - COVID-19
    100660846 (IL6)
   05164 Influenza A
    100660846 (IL6)
   05162 Measles
    100660846 (IL6)
   05168 Herpes simplex virus 1 infection
    100660846 (IL6)
   05163 Human cytomegalovirus infection
    100660846 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100660846 (IL6)
   05169 Epstein-Barr virus infection
    100660846 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100660846 (IL6)
   05144 Malaria
    100660846 (IL6)
   05142 Chagas disease
    100660846 (IL6)
   05143 African trypanosomiasis
    100660846 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100660846 (IL6)
   01523 Antifolate resistance
    100660846 (IL6)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interleukins
   100660846 (IL6)
SSDB
Motif
Pfam: IL6 GCSF Phage_int_SAM_1 DUF4924
Other DBs
NCBI-GeneID: 100660846
NCBI-ProteinID: XP_003407131
UniProt: G3TFE8
LinkDB
Position
Unknown
AA seq 237 aa
MSEAHSALQPTRNKRELHLPSRSPTMNSLSTSAFSPVAFSLGLLLVMASAFPNPKPLEGD
SKDDAASNRPSLTSPDKTEELIRFILAEISVLRKKMCDKYDKCENSREALAGNNLKLPQM
TEEDGCFHSGFNKETCLMKIITGLSEFQIYLDYLQNKFEGSKANVIVVQNSTKALVQILK
QKIKNPEDVTTPDPTANASLLSKLQLQTEWLKNTTINLILRSLDDFMQFSLRAVRIM
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtctgaggctcattctgcccttcagcccaccaggaacaaaagagagctccatctgccc
tccaggagcccaactatgaactccctctccacaagcgccttcagtccagttgccttctcc
ctggggctgcttctggtgatggcttctgctttccccaacccaaaacccctggaaggagat
tccaaagatgatgccgcctcaaacagaccatcactcacctctccagacaaaaccgaagaa
ctcataaggttcatccttgccgaaatctctgttctgagaaagaagatgtgtgacaaatat
gacaagtgtgaaaacagcagggaggcactggcaggaaacaatctgaagcttccacagatg
acagaagaagatggatgcttccactctggattcaataaggagacttgtctgatgaaaatt
atcactggtctttcggagtttcaaatatacctggattacctgcagaacaagttcgagggc
agtaaggcaaacgtcatagttgtgcagaacagcaccaaagccctggtccagatcctgaag
caaaagataaagaatccagaagacgtaaccacccctgacccaactgcaaatgccagcctg
ctgtctaagctgcagctgcagactgagtggctgaagaacacaacgattaacctcatcctg
cgaagcctggatgacttcatgcagttcagcctgagggctgttcggataatgtaa

DBGET integrated database retrieval system