KEGG   Loxodonta africana (African savanna elephant): 100660860
Entry
100660860         CDS       T04351                                 

Gene name
POU1F1
Definition
(RefSeq) pituitary-specific positive transcription factor 1
  KO
K09363  POU domain transcription factor, class 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100660860 (POU1F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100660860 (POU1F1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    100660860 (POU1F1)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN Lsr2
Other DBs
NCBI-GeneID: 100660860
NCBI-ProteinID: XP_023403939
LinkDB
Position
Unknown
AA seq 357 aa
MSCQPFTSADTFIPLNSDSSATLPLMMHHSAAECLPVSNHATNVMSTGTYSSENSSAKRE
KILAYNFKGHTNVYIFKCLPSSYIFLPVPSILSLIQTPKCLRIHFLVTTLGNTATGLHYS
VPSCHYGNQASTYGVMAGSLTPCLYKFPDHTLSHGFPPMHQPLLAEDPTAADFKQELRRK
SKLVEEPVDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFE
NLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFG
EQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFTISKEHLECR
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgagttgccaaccttttacttcagctgacacctttatacctctgaactctgattcttct
gcaacgctgcctctgatgatgcatcacagtgctgccgagtgtctaccagtctccaatcac
gccaccaacgtgatgtctacaggaacctactcatcagagaactcctctgctaaaagagaa
aagattttggcatataactttaaaggtcacacaaatgtatatatttttaagtgtcttcca
tcctcatacattttcttaccagttccgtctattttgtctttgatccaaactcctaaatgt
ttgcgcatacatttcttggtgacaactttgggaaacacagcaacaggacttcactattct
gttccttcctgtcattatggaaaccaggcatcaacctatggagtgatggcaggtagccta
actccttgcctttataagtttcctgatcatactttgagtcatggatttccccccatgcac
cagcctctcctggcagaggaccccacggccgctgatttcaagcaggaactcagacgaaaa
agtaaattggttgaagagccagtagacatggattctccagaaatccgagaacttgaaaag
tttgccaatgaatttaaagtgagaagaattaagttaggatacacccaaacaaacgttggg
gaagctctggcagctgtgcatggctctgaattcagtcaaacgactatctgccgatttgaa
aacctgcagctcagctttaaaaacgcgtgcaaactaaaagcaatattatccaaatggtta
gaggaagctgagcaagtaggagcattatacaatgaaaaagtgggagcaaatgaaaggaaa
aggaagcggagaacaaccataagtattgctgctaaagatgctctggagagacacttcgga
gaacagaacaagccctcttctcaagagatcatgcggatggcagaagagctgaatcttgag
aaagaagtagtaagagtttggttttgcaaccgaaggcagagagaaaaacgggtgaaaaca
agtctgaatcagagcttatttactatttctaaggagcaccttgagtgcagataa

DBGET integrated database retrieval system