KEGG   Loxodonta africana (African savanna elephant): 100660871
Entry
100660871         CDS       T04351                                 

Gene name
PDE3B
Definition
(RefSeq) LOW QUALITY PROTEIN: cGMP-inhibited 3',5'-cyclic phosphodiesterase B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04371  Apelin signaling pathway
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100660871 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100660871 (PDE3B)
   04024 cAMP signaling pathway
    100660871 (PDE3B)
   04022 cGMP-PKG signaling pathway
    100660871 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660871 (PDE3B)
   04922 Glucagon signaling pathway
    100660871 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    100660871 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    100660871 (PDE3B)
   04924 Renin secretion
    100660871 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100660871 (PDE3B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100660871 (PDE3B)
SSDB
Motif
Pfam: PDEase_I DUF1129
Other DBs
NCBI-GeneID: 100660871
NCBI-ProteinID: XP_023406694
LinkDB
Position
Unknown
AA seq 1130 aa
HEEGRRDAKHAVPQPPDGAGSPPESLRNGYVRAAXAPCGQDPPRGFFFHLCRFCNVELLL
PPSASPQQXRRGSPFSRARLSLGALAAFVLALLLGSGPGSWAAGAALLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRFGGGGGSWWLLALPACCYLGDFLAWQWWSSSWG
DGGAEVPEPPHTPPAPHTPPAALGRLFLVLSCVGLLTLLHPVRLQHSILVLLFSSFVWWV
SFTSLGSLPAPLRPLLSCLVGSAGCLLAQGLDHFFQIREAPHHHPRLSSTAEEKVPVIRP
RRRSSCVSLGETSASYYGSCKMFRRPSLPCISREQMILWDWDLKQWYKLHYQNSGGGNGI
DLSVLNEARNMVSDLLTDPTLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCS
EMEDPAEKGDRKLHKGVNSRSSLPTPQLRRSSGTSGLPPIEQSSSRWERNNGKRPHQEFG
ISSQGCYLNGPFSSNLLTIPKQRSSSVSFTHHINLRRAGALSSVSPVTSPTHGPVSAGSL
TNRSPIEFPDTADFLTKPSVILHKSVGNVPNTPDSYQQLRNSDNNLCNSCGHQILKYVAT
PESESGTDCHSGKSGEEKNTIFSKESFKLTDTQEEKTEKIDCKQLFLEGDNQRREEARNE
QQPNMEQESSLDLILIEDHDSLIEKMSNWNFQIFELVEKMGEKSGRILSQVMYTLFQDTG
LLEIFKIPTQQFMNYFHALENGYRDIPYHNRIHATDVLHAVWYLTTRPIPGFQQTHNDHG
TANEADSDGRINPARIAYISSKSCSIPDESYGCLSSNIPALELMALYVAAAMHDYDHPGR
TNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLNLDHVEFKRFRFLVIE
IILATDLKKHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCMKLADINGPAKVRDLH
LKWTEGIVNEFYEQGDEEANLGLPVSPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGL
LPGQWIETEEDDDIESDDEEEDAEELDTDDEEMEDTLNPKPQRRKGRRRIFCQLMHHLTE
NHKIWKEIIEEEEKCKADGNKLQVDNSSLPQADEIQVIEEADEEEERQFE
NT seq 3393 nt   +upstreamnt  +downstreamnt
catgaggagggacgacgagacgccaagcatgcggtaccgcagcctccggacggggccggc
tcgccccctgagagtctgaggaacggctacgtgagagctgcgtgagccccttgcgggcag
gaccctccccgcggcttcttcttccacctttgccgcttctgcaacgtggagttgttgctg
ccaccgtcggcctccccccagcagncgcggcgcggctcccccttctcccgggcgcgcctc
tcgttgggcgccctggctgcctttgtcctcgccctgctgctcggctcggggcccgggagc
tgggctgcgggggccgccctgctgcggaccttgctgagcgtctgctcgcacagcctcagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctgacccggaccaag
cggggccccgggccgggccggttcggcggcggtggcggctcctggtggctgctggcgctg
ccagcttgctgttacctgggggacttcttggcgtggcagtggtggtcttcgtcgtgggga
gacggaggcgcggaggtccccgagcctccgcacacgcccccggccccgcacacgccccca
gccgccttgggcaggttgttcttggtgctgagctgtgtgggtttgctgacgctcctgcac
ccggtgaggctccagcacagcatcctggtactgctcttctccagctttgtctggtgggtc
tccttcaccagcctcgggtcgctgcctgcacccctcaggcccctgctgtcctgcctggtg
gggagcgctggctgcctgctggcccaggggttggatcacttctttcaaatcagggaagct
cctcatcatcatcctcggttgtccagtaccgcggaagaaaaagtgcctgtgatcagaccc
cggaggaggtccagctgcgtgtcgctaggagagacttcagccagttactatgggagttgc
aaaatgttcaggagaccttcgttgccttgtatatccagagaacagatgattctttgggat
tgggatttaaagcagtggtataaacttcattatcagaattctggaggtggaaatggaatt
gatctttcagtgttaaacgaagctcgtaacatggtgtcagacctcctgactgatccaacc
cttcccccacaagtcatttcttccctacggagtatcagtagcttgatgggtgctttctca
ggttcctgtaggccaaagattaatcctctgacaccgtttcctggattttacccctgctct
gaaatggaggacccagctgagaaaggagatcgaaagcttcacaagggagtaaacagtagg
agtagtttaccaacaccacagctgaggaggagttcaggaacttccggtctgccacccatt
gaacagtcttcttcaaggtgggaacgtaataatggcaaaagacctcatcaagaatttggc
atttcaagtcaaggatgctatctaaatggaccatttagttcaaatctactgacaattccg
aagcaaaggtcttcttctgtatcatttactcaccatataaatctgagaagagctggtgct
ttatccagtgtgagtcctgtgacttctcccacccatggaccagtgtctgctggttctcta
actaatcggtcacctatagaatttcctgacactgctgattttcttactaagccaagtgtt
attttacacaaatctgtgggcaatgtacccaataccccagattcttatcagcagcttaga
aattctgataacaatctttgtaacagctgtggacatcaaatactgaaatacgttgcaaca
cctgaatcagaatctggtacagactgccacagtggaaaatcaggtgaagaaaaaaatacc
attttctcaaaagaatcattcaaacttacagatactcaagaagagaaaacagagaagata
gactgcaaacagttattcctggaaggtgataatcaacgaagagaagaggcacggaatgaa
caacaaccaaatatggaacaagaatcatcactggacttgattttaatagaagatcatgac
tcattaatagaaaagatgagcaactggaattttcaaatttttgaacttgtagaaaagatg
ggagagaaatcaggaaggattctcagtcaggttatgtataccttatttcaagacactggc
ttgttggaaatatttaaaattcccactcaacaattcatgaactattttcatgcattagaa
aatggctatcgagacattccttatcacaatcgtatacatgccacagatgtcttacatgca
gtttggtatctgacaacgcggccaattcctggttttcagcagactcacaatgatcatgga
accgcaaatgaagcagattctgatgggagaatcaatcctgcacgaattgcttatatttct
tcaaagagctgctctattccggatgagagctatggctgcctgtcttcaaatattcctgcg
ttggaattgatggctctgtatgtggcagctgccatgcacgattatgatcaccccgggcgg
acaaatgcatttctagtggctacaaatgcccctcaggcagttttgtacaatgacagatct
gttcttgaaaatcatcatgctgcatcagcttggaatttatatctttctcgcccagagtac
aactttcttcttaatctcgatcatgtagaattcaagcgctttcgttttttagtcattgaa
ataatccttgccacagatcttaaaaagcattttgatttccttgctgaattcaatgccaag
gccaatgatgtaaatagtaatggtatagaatggagtaatgaaaatgatcgcctcttagtg
tgccaagtatgcatgaaactagcagatataaatggcccagcaaaagttcgggacttgcat
ttgaaatggacagaaggcattgtgaatgaattttatgagcagggagatgaagaagcaaat
cttggtctgcctgtcagtccgttcatggatcgctcctctcctcaactagcaaaactccaa
gaatcttttatcacccacatagtgggccccctgtgtaactcctatgatgctgctggttta
ctacctggccagtggattgaaacagaagaggatgacgatattgaaagtgatgatgaggaa
gaagatgctgaagaattagatacagatgatgaagaaatggaagacactctaaatcctaaa
ccacaaagaaggaaaggcagacggcgaatattttgtcaactaatgcaccacctcaccgaa
aaccataagatatggaaagaaatcatagaggaagaagaaaaatgtaaagctgatgggaat
aaactgcaggtggacaattcttccttacctcaagcagatgagattcaggtcattgaagaa
gcagatgaagaggaagagcgacagtttgaataa

DBGET integrated database retrieval system