KEGG   Loxodonta africana (African savanna elephant): 100660874Help
Entry
100660874         CDS       T04351                                 

Gene name
ADPRH
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
lav  Loxodonta africana (African savanna elephant)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100660874 (ADPRH)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     100660874 (ADPRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH c-SKI_SMAD_bind
Motif
Other DBs
NCBI-GeneID: 100660874
NCBI-ProteinID: XP_003412891
UniProt: G3TI39
LinkDB All DBs
Position
Unknown
AA seq 362 aa AA seqDB search
MCGKLIERYVAAMVLSAAGDTLGYYNGKWEFLRDGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALIEAGKAGDLAQQYSLLAKHYQNCMEDMDGRAPGGASVQNAMQLEPHKA
NGWRIPFNNHEGGCGAAMRAMCIGLRFPHQSQRDMLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQEWGKGLMEVLPEAKKYIVQSGYFVEENLQHWSYFQDQWEKYLKLRG
IRDGRSAPTFPKSFDVKERDQFYTSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVI
AL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggaagctgatagagaggtacgtggctgccatggtactgagtgcagctggagat
accctggggtactacaatggaaagtgggagttcctccgggatggagaaaagattcaccgg
cagctggcccagcttgggggcttggacgccatagacgtggagaggtggagagtcagcgat
gacacagtgatgcacctggctacagcggaagccctcatagaggctgggaaagctggggac
ttggctcaacagtattccctccttgctaagcattaccaaaactgcatggaagatatggac
ggccgagcgccaggtggagcctcagtgcagaacgccatgcagctggagccgcacaaggcc
aatggctggaggattcccttcaacaaccacgagggtggctgtggggctgccatgcgggcc
atgtgcatcggtctcaggttccctcaccaaagccagagggacatgttgatccaagtgagc
atcgagagtggccggatgacccaccaccaccccacaggctacctgggtgcccttgtgtct
gctctttttacagcctatgctgtgaatggcaaaccaccccaggaatggggaaaaggtctg
atggaggtgctaccagaagctaaaaagtacattgtccaatcaggctactttgtggaggag
aatcttcagcactggtcctacttccaagaccaatgggaaaagtatctaaaactcagaggg
attcgggatggcagatcagcccctaccttcccgaagtcctttgatgtgaaagagagagat
cagttctacacttctgtgagctactctggttggggcggcagtagtgggcacgatgccccc
atgattgcctatgatgccatccttgctgcaggtgactcctggaaggagcttgcccatcga
gcctttttccatggtggagacagcgattccacggctgccattgccggctgctggtgggga
gttatgtatggttttaaaggagtgagtccttctaactatgagaaactagaatacagaaac
cgactggaagagacagcgagggctttatactctcttggttcaaaggaagatactgtaatt
gccctctag

DBGET integrated database retrieval system