KEGG   Loxodonta africana (African savanna elephant): 100660875
Entry
100660875         CDS       T04351                                 

Gene name
NPPA
Definition
(RefSeq) natriuretic peptides A
  KO
K12334  natriuretic peptide A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04270  Vascular smooth muscle contraction
lav04714  Thermogenesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100660875 (NPPA)
   04024 cAMP signaling pathway
    100660875 (NPPA)
   04022 cGMP-PKG signaling pathway
    100660875 (NPPA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100660875 (NPPA)
   04921 Oxytocin signaling pathway
    100660875 (NPPA)
   04924 Renin secretion
    100660875 (NPPA)
   04925 Aldosterone synthesis and secretion
    100660875 (NPPA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100660875 (NPPA)
  09159 Environmental adaptation
   04714 Thermogenesis
    100660875 (NPPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    100660875 (NPPA)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 100660875
NCBI-ProteinID: XP_003413211
UniProt: G3TP61
LinkDB
Position
Unknown
AA seq 153 aa
MGSFSTITVCFLLFLAFQLPGQIRANPVYTSVSNADLMDFKNLLDRLEDKMPLEDEVVPP
QVLNEQNDEAGVAVNPLPEVPPWTREVSPAQRDGGALGRGPWDSSERSALLKNKLRALLT
APRSLRRSSCFGGRIDRIGSQSGLGCNSFRYRR
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggctccttctccaccatcactgtgtgcttcctcctcttcctggcatttcaactccca
ggtcaaatcagagcgaaccctgtgtacacctccgtgtccaatgcagacctgatggatttc
aagaatttgctggaccgtttggaggacaagatgcctttagaagatgaggtcgtgccccca
caagtactaaacgagcagaatgatgaggctggggtggctgtcaaccccctgcctgaggtg
cctccctggaccagggaggtcagcccagctcagcgagatgggggtgctcttgggaggggc
ccctgggactcctccgaaagatctgccctcctgaaaaacaagctgagggcactactcact
gcccctcggagcctgcggaggtccagctgcttcgggggcaggattgacaggattggatcc
cagagtggcctcggctgcaacagtttccggtaccgaagataa

DBGET integrated database retrieval system