KEGG   Loxodonta africana (African savanna elephant): 100660883
Entry
100660883         CDS       T04351                                 

Gene name
MMP13
Definition
(RefSeq) collagenase 3
  KO
K07994  matrix metalloproteinase-13 (collagenase 3) [EC:3.4.24.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04657  IL-17 signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100660883 (MMP13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100660883 (MMP13)
   04928 Parathyroid hormone synthesis, secretion and action
    100660883 (MMP13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100660883 (MMP13)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100660883 (MMP13)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100660883 (MMP13)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_4 Reprolysin_3 DUF4953 Reprolysin_5
Other DBs
NCBI-GeneID: 100660883
NCBI-ProteinID: XP_003415654
UniProt: G3SXB4
LinkDB
Position
Unknown
AA seq 471 aa
MHPGVLAAFFLLSWTHCWSLPLPDDDDSDDLSEEDFQFAEHYLKSYYNPQNPAGILKKNA
VSSVVDRLREMQSFFGLEVTGKLDDNTLNIMKKPRCGVPDVGQYNVFPRTLKWSNMDLTY
RIVNYTPDLTHSEVEKAFRKAFKVWSDVTPLNFTRLHNGTADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNFGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKGHFVLPDDDVQGIQALYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MVFKDRFFWRLHPQQVEAELFLTKSFWPEVPNRIDAAYEHPSRDLIFMFRGRKFWALNGY
DILEGYPKKISELGFPKEVKMISAAVHFENTGKTLFFSGNQVWRYDDTNHIMDKHYPRLI
EEEFPGIGDKVDAVYEKNGYIYFFNGHIQFEYSIWSNRVVRVMPTNSLLWC
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgcatcccggtgtcctggcagcctttttcctcttgagctggacccattgttggtccctg
ccccttcctgatgatgacgatagtgatgatttgtctgaggaagacttccagtttgccgag
cactacctgaaatcatactacaatcctcagaatcctgctggaatcctgaagaagaatgca
gtaagctccgtggttgataggctccgagaaatgcagtcttttttcggcttagaagtgacc
ggcaaacttgacgataacaccttaaatatcatgaaaaagccaagatgtggagtccctgat
gtgggtcaatacaatgttttccctcgaaccctcaaatggtctaacatggatttaacctac
aggattgtgaattataccccggatctgactcattctgaagttgaaaaggctttcagaaaa
gccttcaaagtttggtctgatgtgacacctctgaactttaccagacttcacaatggcact
gctgatatcatgatctcttttggaattaaagagcatggtgacttctatccatttgatggc
ccctctggtctgctggctcatgcttttcctcctgggccaaattttggaggagatgcccat
tttgatgatgacgaaacctggacaagtagttccaaaggctacaacttgttccttgttgct
gcccatgagtttggccactccttgggtcttgaccactccaaggacccaggagcactcatg
tttcccatctacacctacactggcaaaggccactttgtacttcctgatgatgatgttcaa
gggatccaggctctctatggtccaggagatgaagaccccaaccctaaacatcccaaaact
ccagacaaatgcgatccttccttatcccttgatgctattaccagtctccgaggagaaaca
atggtctttaaagacagattcttctggcgcctgcatcctcagcaggttgaggcagagctg
ttcttaacgaaatcattttggccggaagttcccaaccgtattgatgctgcctacgagcat
ccttcacgtgaccttatcttcatgtttagaggaagaaaattttgggctcttaatggttat
gatattctggaaggttatccaaaaaaaatatctgagctaggatttccgaaagaggtaaaa
atgataagtgcagctgttcactttgagaatacgggcaagactctcttcttctcaggaaac
caagtctggagatatgatgatactaaccatattatggataaacactacccgagactaata
gaagaagagttcccaggaattggtgataaagtagatgctgtctacgagaaaaatggttac
atctattttttcaatggacacatacaattcgaatacagtatctggagtaaccgcgttgtt
cgcgtcatgccaacaaattctttattgtggtgttaa

DBGET integrated database retrieval system