KEGG   Loxodonta africana (African savanna elephant): 100660893
Entry
100660893         CDS       T04351                                 

Gene name
SSTR2
Definition
(RefSeq) somatostatin receptor type 2
  KO
K04218  somatostatin receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100660893 (SSTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100660893 (SSTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100660893 (SSTR2)
  09154 Digestive system
   04971 Gastric acid secretion
    100660893 (SSTR2)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Somatostatin
    100660893 (SSTR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv FtsK_4TM
Other DBs
NCBI-GeneID: 100660893
NCBI-ProteinID: XP_003417329
UniProt: G3UL98
LinkDB
Position
Unknown
AA seq 369 aa
MDMAYELLNGSQAWLSSSLDLNGSVVAANGSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIY
AGLRSNQSGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatatggcatacgagctactcaatgggagccaagcgtggctgtcctcctcgttggac
ctcaatggttcagtggtggcagccaatggctccaaccaaacagagccgtactatgacctg
accagcaatgcagtcctcacattcatatattttgtggtctgcatcattgggttgtgtggc
aacacgctcgtcatttatgtcatcctccgctatgccaagatgaaaaccatcaccaacatt
tacatcctcaacctggccatcgcggatgagctcttcatgctgggcctgccctttttggcc
atgcaggtggctctggtccactggccctttggcaaggccatctgccgggtggtcatgact
gtggatggcatcaatcagttcaccagcattttctgcttgacagtcatgagcattgaccgc
tacctggccgtggtccaccccatcaagtcggccaagtggaggagaccccggacagccaag
atgatcaacgtggctgtgtggggagtctctctgctggtcatcttgcctatcatgatatat
gccggtcttcggagcaaccagtcagggagaagcagctgcaccatcaactggccaggtgaa
tctggggcatggtacacagggttcattatctataccttcatcttggggttcctggtaccc
cttaccatcatttgtctttgctacctgttcattatcatcaaggtcaagtcctctggaatc
cgagtgggttcctccaagaggaaaaagtcagagaagaaggtcacacggatggtgtccata
gtggtggctgtcttcattttctgctggctccccttctacatctttaatgtctcatcggtt
tctgtggccatcagtcccactccagccctcaaaggcatgtttgactttgtggtggtcctc
acctatgctaatagctgtgccaaccccatcctatatgccttcttgtctgacaacttcaag
aagagcttccagaatgtcctctgcttggtcaaggtgagcggcacagatgatggggaacgg
agtgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagatctccagaccagtatctga

DBGET integrated database retrieval system