KEGG   Loxodonta africana (African savanna elephant): 100660893
Entry
100660893         CDS       T04351                                 

Gene name
SSTR2
Definition
(RefSeq) somatostatin receptor type 2
  KO
K04218  somatostatin receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100660893 (SSTR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100660893 (SSTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100660893 (SSTR2)
  09154 Digestive system
   04971 Gastric acid secretion
    100660893 (SSTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100660893 (SSTR2)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Somatostatin
    100660893 (SSTR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv FtsK_4TM
Other DBs
NCBI-GeneID: 100660893
NCBI-ProteinID: XP_003417329
UniProt: G3UL98
LinkDB
Position
Unknown
AA seq 369 aa
MDMAYELLNGSQAWLSSSLDLNGSVVAANGSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIY
AGLRSNQSGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatatggcatacgagctactcaatgggagccaagcgtggctgtcctcctcgttggac
ctcaatggttcagtggtggcagccaatggctccaaccaaacagagccgtactatgacctg
accagcaatgcagtcctcacattcatatattttgtggtctgcatcattgggttgtgtggc
aacacgctcgtcatttatgtcatcctccgctatgccaagatgaaaaccatcaccaacatt
tacatcctcaacctggccatcgcggatgagctcttcatgctgggcctgccctttttggcc
atgcaggtggctctggtccactggccctttggcaaggccatctgccgggtggtcatgact
gtggatggcatcaatcagttcaccagcattttctgcttgacagtcatgagcattgaccgc
tacctggccgtggtccaccccatcaagtcggccaagtggaggagaccccggacagccaag
atgatcaacgtggctgtgtggggagtctctctgctggtcatcttgcctatcatgatatat
gccggtcttcggagcaaccagtcagggagaagcagctgcaccatcaactggccaggtgaa
tctggggcatggtacacagggttcattatctataccttcatcttggggttcctggtaccc
cttaccatcatttgtctttgctacctgttcattatcatcaaggtcaagtcctctggaatc
cgagtgggttcctccaagaggaaaaagtcagagaagaaggtcacacggatggtgtccata
gtggtggctgtcttcattttctgctggctccccttctacatctttaatgtctcatcggtt
tctgtggccatcagtcccactccagccctcaaaggcatgtttgactttgtggtggtcctc
acctatgctaatagctgtgccaaccccatcctatatgccttcttgtctgacaacttcaag
aagagcttccagaatgtcctctgcttggtcaaggtgagcggcacagatgatggggaacgg
agtgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagatctccagaccagtatctga

KEGG   Loxodonta africana (African savanna elephant): 100665784
Entry
100665784         CDS       T04351                                 

Gene name
SSTR1
Definition
(RefSeq) LOW QUALITY PROTEIN: somatostatin receptor type 1
  KO
K04217  somatostatin receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100665784 (SSTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100665784 (SSTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100665784 (SSTR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100665784 (SSTR1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Somatostatin
    100665784 (SSTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 T2SSM Piezo_RRas_bdg
Other DBs
NCBI-GeneID: 100665784
NCBI-ProteinID: XP_010586903
LinkDB
Position
Unknown
AA seq 390 aa
MFPNGTASSPPSSPSPSPSSCSEGGGRGPGAGATDGMEEPGRNASQNGTLSEGQGSAILI
SFIYSVVCLVGLCGNSMVIYVILRYXKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR
HWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGV
WVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICL
CYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDD
ATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKSR
AYSVEDFQPENLESAGVFRNGTCTSRITTL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgttccccaatggcaccgcctcctctcctccttcctctcctagccctagccccagcagc
tgcagcgaaggcggcggcaggggccccggggccggcgccacggacggcatggaggaacca
gggcgcaacgcgtcccagaacgggaccttgagcgagggccagggcagcgccattctcatc
tctttcatctactcggtggtgtgcctggtggggctgtgtgggaactccatggtcatctac
gtgatcctgcgctacngcaagatgaagacggccaccaacatttacatccttaacctggcc
atcgccgacgagctgctcatgctcagcgtgcctttcctggtcacctccactctgctgcgc
cactggcccttcggcgcgctgctctgccgcctcgtgctcagcgtggacgcggtcaacatg
ttcaccagcatctactgcctgactgtcctcagtgtggaccgctatgtggctgtggtgcac
cccatcaaggcggcccgctaccgccggcccaccgtggccaaggtggtgaacctgggtgtg
tgggtgctgtcgctgcttgtcatcctacccatcgtggtcttctcgcgcaccgcggccaac
agcgacggcactgtggcctgcaacatgctcatgcccgagcccgcccagcgctggctggtg
ggcttcgtgctgtacacgttccttatgggcttcctgctgcctgtcggagccatctgcctg
tgctacgtgctcatcattgccaagatgcgcatggtggccctcaaggccggctggcagcag
cgcaagcgctcggagcgcaagatcaccctgatggtgatgatggtggtgatggtgttcgtc
atctgttggatgcctttctatgtggtgcagctggttaacgtgttcgcggaacaggacgac
gccacggtgagccaactctcggtcatccttggttacgccaacagctgcgccaaccctatc
ctctatggcttcctctcggacaacttcaagcgctctttccaacgcatcctgtgcctcagc
tggatggacaacgccgccgaggagcctgtcgactactacgccacggctctcaagagtcgc
gcctacagcgtggaggacttccagcctgagaacctggagtccgccggcgtcttccgtaac
ggcacctgcacttcccggatcacgacgctctga

KEGG   Loxodonta africana (African savanna elephant): 100670370
Entry
100670370         CDS       T04351                                 

Gene name
SSTR3
Definition
(RefSeq) somatostatin receptor type 3
  KO
K04219  somatostatin receptor 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670370 (SSTR3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100670370 (SSTR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100670370 (SSTR3)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Somatostatin
    100670370 (SSTR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw SRP-alpha_N
Other DBs
NCBI-GeneID: 100670370
NCBI-ProteinID: XP_023415703
LinkDB
Position
Unknown
AA seq 426 aa
MDTSGYSPPVPTTLEPGNTSLAWLLDATLGNRSGGPSPAGLAVSGILIPLVYLVVCVVGL
LGNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSVAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRAAFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRR
VQAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVV
ALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPAAGPPEKTKEDEEEDGEEG
EEESGREGAEKQAEGKEKNSRVSQITQPGTSGQEQPPSGSAGKEQQSLPREPSAGEKSSA
LHISYL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggacacctctggctactctccaccagtgcccacaaccttggaacccgggaacacctcc
ttggcttggctcctggatgctaccctgggaaataggtcggggggcccaagcccagcaggg
ctggctgtcagcggcattctgatccccttggtctacctggtggtgtgcgtggtgggcctg
ctaggcaactcgctggtcatctacgtagtcctgcggcacacggccagcccatcagtcacc
aacgtctacatcctcaacctggcgctggccgacgagctcttcatgttggggctgcccttc
ctggctgctcagaatgccctgtcatactggccgtttggctccctcatgtgccgcctggtc
atggccgtggatggcatcaaccagttcaccagcatcttctgcctcactgtcatgagtgtg
gaccgctacctggcggtggtgcaccctacccgctcggcccgctggcgaacggcgccagtg
gcccgcacggtcagcgtggccgtctgggtggcctcagccgtggtggtgctgcccgtggtg
gtcttctcgggtgtgccccgtggcatgagcacctgccacatgcagtggcctgagcctgcg
gcggcctggcgggccgccttcatcatttacacagccgccctgggcttcttcgggccgctg
ctggtcatctgcctctgctacctgcttatcgtggtgaaggtgcgctcggctgggcggcgg
gtgcaggcgccctcgtgccagcggcggcggcgctctgagcgtagggtcacacgcatggtg
gtggccgtggtggcgctctttgtcctttgctggatgcccttctacgtgctcaacattgtc
aacgtggtgtgcccactgcctgaggagcccgccttcttcggcctctacttcctcgtggtg
gcactgccctatgccaacagctgtgccaaccccatcctgtatggcttcctctcctaccgc
ttcaagcagggcttccgcagggtcttgctgcggccttcccgccgcgtgcgcagccaggag
cctgcagcagggcctccggagaagaccaaagaggatgaggaggaggatggagaggagggc
gaggaggagagtggaagagagggggcagagaagcaggcggaggggaaggagaagaacagc
cgggtcagccagatcacccagcctggcaccagtgggcaggagcagccacccagtggctcg
gcaggcaaggagcagcaatccctgccccgagagccctctgctggggagaagtccagtgcc
ctgcacatcagctatctgtag

KEGG   Loxodonta africana (African savanna elephant): 100671401
Entry
100671401         CDS       T04351                                 

Gene name
SSTR5
Definition
(RefSeq) somatostatin receptor type 5
  KO
K04221  somatostatin receptor 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100671401 (SSTR5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100671401 (SSTR5)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100671401 (SSTR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100671401 (SSTR5)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Somatostatin
    100671401 (SSTR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 100671401
NCBI-ProteinID: XP_003417745
UniProt: G3UF91
LinkDB
Position
Unknown
AA seq 368 aa
MEPLFPVASTFRLASWNASPVVPGGVENGTLAGPLGSPGARAVLIPVLYLLVCAIGLGGN
TLVIYVVLRYAKMKTVTNIYILNLAVADVLFMLGLPFLATQNAVSYWPFGSLLCRVVMTL
DGINQFTSIFCLTVMSVDRYLAVVHPIRSTKWRQPRVAKLTSAAVWTFSLLMSLPLVVFA
DIQEGWDTCNLSWPEPVGLWGAVFIIYTSVLGFFGPLLVICLCYLLIVVKVRAMGVRVGC
TRRRRAERKVTRMVVVVVLVFVGCWLPFFIVNIINLAFILPEEPASAGVYFFVVILSYAN
SCANPILYGFLSDNFRQSFRKVLCLRKGYGVEDADIAEPRLDKSSQLREASMPRPGPQAD
RHMQTSTL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggagcctctgttcccggtggcctccaccttcaggctggccagctggaatgcctcccca
gtggtccctgggggcgttgagaatggaacactggctgggccattgggctcaccgggggcc
cgggcagtcctcatccctgtgctctacctgctggtgtgtgccataggtctgggcggcaac
acactggtcatttatgtggtgctgcgctacgccaagatgaagaccgtcaccaacatctac
atcctcaacctggcagtggctgatgtcctcttcatgctggggctgcccttcctggccaca
cagaatgctgtgtcctactggccctttggctcactgctgtgccgtgtggtcatgacactg
gatggcatcaaccagttcaccagcatcttctgtctgaccgtcatgagcgttgaccgttac
ctagccgtggtacaccccatacgctccaccaagtggcgccagccacgcgtggccaagctc
accagcgctgctgtctggaccttctcgctgctcatgtcactgcccctggtggtctttgct
gacatccaggagggctgggacacctgcaacctcagctggccggagcctgtggggctctgg
ggtgctgtcttcatcatctacacctctgtgctgggcttctttggaccgctgctggtcatc
tgcttgtgctacttgctcatcgtggtcaaggtgagggcaatgggcgtgcgtgtaggctgc
acgcggcggcgtagggcagagcgcaaggtaactcgcatggtggtggtggtggtgttggtg
ttcgtgggctgctggctgcccttcttcatcgtcaacatcatcaacctggccttcatcctg
cctgaggagcctgcctccgctggtgtctacttcttcgtggtcatcctctcctacgccaac
agctgtgccaaccccatcctgtacggattcctctctgacaacttccggcagagcttccgg
aaggttctgtgcctccgaaagggctatggtgtggaggatgcagacatcgctgagccaagg
ctggacaagagcagccagctgcgggaggcatcgatgcccaggcctggcccccaggccgac
aggcacatgcagaccagcacactgtga

DBGET integrated database retrieval system