KEGG   Loxodonta africana (African savanna elephant): 100660904
Entry
100660904         CDS       T04351                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6 isoform X1
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04660  T cell receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05170  Human immunodeficiency virus 1 infection
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100660904
   04014 Ras signaling pathway
    100660904
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100660904
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100660904
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100660904
  09158 Development and regeneration
   04360 Axon guidance
    100660904
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100660904
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100660904
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100660904
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100660904
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100660904
NCBI-ProteinID: XP_003418700
UniProt: G3T813
LinkDB
Position
Unknown
AA seq 683 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSSVPTDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDD
HWATDPDMYLQSPQSERTDPHGLYLSCNGGAPAGHRQMPQPEPQSPRVLTNGLAEKAQSL
GPAEFHGAVQRCLQLGACLQSSPPGTSPPTATGRRGTKAARHGSEEPRPQSCLVGSGTSR
PGGEGSPSPETQESSLKRRLFRSMFLSTPATATAPPSSSKPGPPAQSKPNSSFRLLQKDL
PPNLVAKAQSLPSDQPAGNFSPLSTLDTSSPQKSLRTAPAAGPPPGRSSPAGSPRTRHAQ
ISTSNLYLPQDPVVARGALAVEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGST
GIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVDMYKSYLVGEELW
VLMEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDG
RVKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGE
PPYFSDSPVQAMKRLRDSPPPRLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFL
LQTGLPECLVPLIHLYRKQTSTC
NT seq 2052 nt   +upstreamnt  +downstreamnt
atgttccgaaagaaaaagaagaaacgccctgagatctctgctccacagaactttcagcac
cgtgtccacacctccttcgacccaaaagaaggcaagttcgtgggcctccccccacaatgg
cagaacattctggacacactgcggcgacccaagcctgtggtggacccttcgcgcatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagctcggtgcccacagacggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgcggccgcagccccaccagccgccggcgggcacagtccctgggactgttgggggacgac
cactgggccaccgatccggacatgtacttgcagagcccccagtctgagcgcactgacccc
cacggcctctacctcagctgcaacgggggtgccccagcaggccacaggcagatgccacag
cccgagccgcagagcccacgggtcctgaccaatgggctggccgagaaggcacagtcgctg
ggccctgccgagttccacggtgccgtgcagcgctgcctgcagctgggcgcctgcctgcag
agttctccaccaggtacctcaccccccacggccactggtaggcgtgggaccaaggctgcc
aggcacggctccgaggagcctcggccacagtcttgcctggtgggctcgggcacaagcagg
cccggcggggagggcagccccagccctgagacccaggagagcagccttaagcgcaggctg
tttcgaagcatgttcctgtccactcctgctacggccacagccccgccaagcagcagcaag
ccaggccctccggcacagagcaagcccaactcctctttccgactgctgcagaaagacttg
cccccaaatctggtggccaaggcccagtccttgccctcggaccagcctgcggggaacttt
agccctctgagcaccttggataccagcagcccccagaagtccctccgcacggccccagcc
gccggcccccctccaggccgatcttccccggcaggctccccccgcacccggcacgcccag
atcagcaccagcaacctgtacctgccccaggaccccgtggtggccaggggtgcgctggcc
gtagaggacacaggcgtcgtgacgcacgagcagttcaaggctgcgctcaggatggtggtg
gaccagggtgacccccggctactgctggacagctacgtgaagattggcgagggctccacg
ggcattgtctgcctggcccgggagaagcactcaggccgccaggtggccgtcaagatgatg
gacctcaggaagcagcagcgccgggagctgctctttaatgaggtggtgatcatgcgggac
taccagcacctcaacgtggtggatatgtacaagagctacctggtgggcgaggagctgtgg
gtgcttatggagttcctgcagggcggtgccctcacagacatcgtctcccaagtcaggctg
aatgaggagcagatcgccaccgtgtgtgaggccgtgctgcaggccctggcttacctgcac
gcccagggcgtcatccaccgggacatcaagagtgactctatcctgcttaccctcgatggc
agggtgaagctctcagacttcggattctgtgctcagatcagcaaagacgtccctaagagg
aagtctctggtgggaaccccttactggatggctccggaggtgatctccaggtctctgtat
gctaccgaggtggatatctggtccctgggcatcatggtgattgagatggtagatggagag
ccaccctacttcagcgactccccagtgcaagccatgaagaggctccgggatagcccccca
cccaggctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatg
ctggttcgggacccccaggagagagccacagcccaggagctcctggaccaccccttcctg
ctgcagacggggctgcccgagtgcctggtgcccctgatccatctctaccgaaagcagacc
tccacctgctga

KEGG   Loxodonta africana (African savanna elephant): 100661100
Entry
100661100         CDS       T04351                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4 isoform X1
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04660  T cell receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05170  Human immunodeficiency virus 1 infection
lav05206  MicroRNAs in cancer
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100661100 (PAK4)
   04014 Ras signaling pathway
    100661100 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100661100 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100661100 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100661100 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    100661100 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100661100 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100661100 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100661100 (PAK4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100661100 (PAK4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100661100 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 100661100
NCBI-ProteinID: XP_010598624
LinkDB
Position
Unknown
AA seq 619 aa
MSNPKPERSCRLPEGTFSRSSIKPGWFPHTGPLGGAQASSAMFGKKKKRVEISAPSNFEH
RVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVRGSKGAKD
GALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGLPQEQAAMARGGPDKAGSRGQAT
TRSEAGGGSSDRRRVGPEKRPKPSREGPRVPQESSWDKRPLSGPDVSGAKLAAGRPFNTY
PRDTDHPSRGAQGEPHGRAPNGPSTGGLSAPQSSSRLPTQVRSAPSPGVLGPHASEPQLA
PLARTPAAPAAPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGST
GIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELW
VVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDG
RVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGE
PPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFL
AKAGPPASIVPLMRQNRTR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgagtaacccaaagccagagaggagttgtcgcctgcctgagggcacttttagcagatcc
agcatcaaaccagggtggttccctcacacaggccccctgggaggagcccaagcgtccagc
gccatgtttggtaagaagaagaagcgggtggagatctcggcgccctctaactttgagcac
cgcgtgcacacgggctttgaccagcacgagcagaagttcacagggctgccccgccagtgg
cagagcctgatcgaggagtcggcgcgccggcccaagccgctcattgaccctgcctgcatc
acctccatccagcctggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggat
ggggccctcacgctgctgctcgacgagtttgagaacatgtcggtgacacgctccaactcc
ctgcggagagacagcccgccaccccctgcccgcgcccgccaggagaacgggctgccccag
gagcaggctgccatggccagagggggcccggacaaagcaggcagccgaggccaggccacc
actcgcagcgaggcgggtggtggcagcagtgacaggcggcgggtggggccggagaagagg
cccaagccttccagggagggcccaagggtgccccaggagtcctcctgggacaaacgcccc
ctctctgggcctgatgtcagcggggcgaaactggcagctggccggccctttaacacatac
ccgcgggacacagaccacccatcccgtggtgcccagggggagcctcacggcagggccccc
aacgggccatccacagggggtctgtctgccccccagtcctcctcccggctccccacccaa
gtccgcagcgcccccagcccgggagtgctgggcccccatgcctctgagccccagctggcc
cctctggcccgcacccctgctgcccctgccgcccccgggccccctggcccccgctcaccc
cagcgggaaccccagcgggtatcccatgagcagttccgggccgccctgcagctggtggta
gacccaggtgaccctcgctcctacctggacaacttcatcaagatcggcgagggctccacg
ggcatcgtctgcattgccaccgtgcgcagctccggcaagctggtggccgtcaagaagatg
gacctgcgcaagcagcagaggcgtgaactgctgttcaacgaggtggtgatcatgcgggac
taccagcacgagaacgtggtggagatgtacaacagctacctggtgggagatgagctctgg
gtggtgatggagttcctggagggaggtgccctcaccgacattgtcacccacaccaggatg
aacgaggaacagattgccgccgtgtgcctggctgtgctgcaggccctgtctgtgctccac
gcccagggtgttatccaccgggacatcaagagtgactccatcctgctgacccacgacggc
cgggtgaagctgtcagactttgggttctgcgcccaggtgagcaaggaggtgccacggagg
aagtcgctggtgggcacaccctactggatggccccggagctcatctcccgccttccctat
gggccagaggtggacatctggtctctgggagtgatggtgatcgagatggtggacggggag
cccccctatttcaacgagccgcccctcaaagccatgaagatgattcgggacaacctgcca
ccccggctgaagaacctgcacaaggtgtcgccatccctgaagggctttctggaccgcctg
ctggtgcgtgaccctgcccagcgggccacagcagctgagctgctgaagcatccgttcctg
gccaaggcgggaccgcccgccagcatcgtgcccctcatgcgccaaaaccgcaccagatga

KEGG   Loxodonta africana (African savanna elephant): 100664379
Entry
100664379         CDS       T04351                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04660  T cell receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05170  Human immunodeficiency virus 1 infection
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664379 (PAK2)
   04012 ErbB signaling pathway
    100664379 (PAK2)
   04014 Ras signaling pathway
    100664379 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664379 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664379 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100664379 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    100664379 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100664379 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100664379 (PAK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100664379 (PAK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100664379 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100664379
NCBI-ProteinID: XP_003412987
UniProt: G3SYT4
LinkDB
Position
Unknown
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGSETSALVAEEDDDDEEAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKPSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcccccagcgccccctgtgcgcatgagcagt
accatttttagcactggaggcaaagaccctctgtcagccaatcacagtttgaaacctttg
ccttctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaggcaca
gagaaaggaagtaagaagaaagagaaggaaaggccagaaatttctcctccctcagatttt
gagcacactatccacgtcggcttcgatgctgttactggagaattcactggcatgccagaa
cagtgggctcggttactgcagacttccaacatcaccaaactagagcagaagaagaaccct
caggctgtgctggatgtgctaaagttctatgactccaacacggtgaagcagaagtacctg
agctttactcctcctgagaaagatggcttcccatctggaacaccagcattgaatgcaaag
ggctcagagacatccgcactagtagcagaggaagacgatgatgacgaagaggctgcccct
cctgtcatcgccccacgaccggatcacacaaaatcaatttatacacggtctgtaatcgat
cctattcctgcaccagttggtgattctaatgttgacagtggtgccaagccttcagacaaa
cagaaaaagaagaccaagatgacagacgaagagattatggagaaattaagaactatcgtc
agcataggtgaccccaagaaaaaatatacaagatatgaaaaaattggacaaggtgcttct
gggacagttttcactgctactgatgtggcattgggacaggaggttgctatcaaacagata
aatttacagaaacaacccaagaaggaattgatcattaatgagattctggtaatgaaagaa
ttaaagaatcccaacatagttaacttcttagacagttacctggtgggagatgaattgttt
gtggtaatggagtaccttgctggcgggtcacttactgatgttgtaacagaaacctgcatg
gacgaagcacagattgctgctgtgtgcagagagtgtttacaggcactggagtttttacat
gctaatcaggtgatccacagagacatcaaaagtgacaacgtgcttttggggatggaagga
tcggttaaacttaccgactttggtttctgtgcccagatcacccctgagcagagcaagcga
agtaccatggttggaacaccttactggatggcaccagaggtggttacacggaaagcctac
ggccctaaagtggacatctggtctctgggtattatggctattgagatggtagaaggagaa
cctccatacctcaatgaaaatcccttgagggccttgtacctgatagcaactaatggaacc
ccagaacttcaaaatccagagaaactttccccaatatttcgggatttcttaaatcgatgt
ttggagatggatgtggagaaaaggggttcagccaaagaattgttacagcatcccttcctg
aagctggccaagccattatctagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgctaa

KEGG   Loxodonta africana (African savanna elephant): 100666744
Entry
100666744         CDS       T04351                                 

Gene name
PAK5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04660  T cell receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05170  Human immunodeficiency virus 1 infection
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100666744 (PAK5)
   04014 Ras signaling pathway
    100666744 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100666744 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100666744 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100666744 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    100666744 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100666744 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100666744 (PAK5)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100666744 (PAK5)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100666744 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100666744
NCBI-ProteinID: XP_010589836
UniProt: G3T174
LinkDB
Position
Unknown
AA seq 721 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPRHS
EENGFTTFSQYSSESDTTTDYTTEKYREKSPYGDDLDPYYRGSHAAKQNGHVVKMKAGEA
YYSDMKPLKSDISRFPGDYHTHLDSLSKPSEYSDLKWDYHRASSSSPLDYRDPFQFTPSR
TAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSRSGSGLQEPTMP
FGASAFKTHPQGHSYNSYTYPRLSEPTTCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLP
QSQSKAGYSPSSHQYPSGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSSYPPPSWSS
SSDQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVK
KMDLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHT
RMNEEQIATVCLSVLRALSYLHHQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVP
KRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMQRIRDS
LPPRVKDLHKFSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRH
H
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgtttggaaagaaaaagaaaaagattgaaatatctggtccatccaactttgaacacagg
gttcatactgggtttgatccacaagaacagaaatttaccggcctccctcagcaatggcac
agcctgttagcagacacagccaacaggccgaagcccatggtagatccttcgtgcatcaca
cccatccagctggctcccatgaagacaatcgttcgaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggatttcgacaacatctcggtgactcgctccaactccctc
aggaaggaaagcccacccaccccagaccagggagcctccagccacggcccacgccattcg
gaagaaaatggcttcaccaccttctcacaatattccagtgaatccgatacaacgactgac
tacaccaccgaaaagtacagggaaaagagtccctacggagacgacttggacccgtattac
agaggcagccacgcggccaagcaaaatgggcacgtagtgaaaatgaaagccggggaggcc
tactattctgacatgaagcctttgaaatccgatatttccagatttcctggcgattatcac
acacacttggactccctgagcaaaccaagtgaatacagtgacctcaagtgggactatcac
agagcctccagtagctccccgctagactaccgagacccgttccaattcactccttctaga
actgcagggaccagcgggtgctcgaaggaaagcctggcgtacagcgaaagtgagtgggga
cccagcctggatgactacgacaggaggccaaagtcgtcctacctgcatcagacgagccct
cagccggccatgcggcagaggtccaggtcaggctcagggctccaggagcccacgatgccg
tttggagcaagtgcatttaagacccatcctcaaggacactcgtacaactcctacacctac
cctcgcttgtccgagcccacaacgtgcattccaaaggtggattatgaccgagcacagatg
gtcctcagccctccactgtctgggtctgacacctaccccaggggccccgccaaactacct
caaagtcaaagcaaagcaggctactccccaagcagccaccagtacccctctgggtaccac
aaagccagtctgtaccaccacccctctctgcagaccagctcccagtacatctccacagct
tcttatctgagctctcttagtatctcgtccagctcctaccccccacccagctggagctcc
tcctcagaccagcagccctccagggtgtcccacgaacagtttcgggctgcgttgcagctg
gtggtcagcccaggagaccccagggaatacttggacaactttatcaaaatcggggaaggc
tcaactggtattgtatgcatcgccacagagaaacacacagggaagcaagtggccgtgaag
aaaatggacctccgaaagcaacaaagacgagagctgctttttaatgaggttgtcataatg
cgggattaccaccatgacaatgtggttgacatgtacaacagctaccttgtcggtgatgaa
ctctgggtagtcatggaatttttagaaggcggtgcactgacagacatagttactcatacc
agaatgaatgaagaacagatagctaccgtctgtctgtcagttctgagagccctctcctac
cttcaccaccaaggagtgatccacagagacatcaagagtgactccattctcctgaccagt
gatggccggataaagttatctgactttggtttctgtgctcaagtctccaaagaggtgcca
aagaggaaatcactagttggcactccatactggatggcacctgaggtgatttctagacta
ccttatggaacagaggtggacatctggtcacttgggatcatggtgatagagatgatcgat
ggtgagcccccctacttcaatgagcctccgctccaggcaatgcagaggatacgggacagt
ttacctccaagagtgaaggacctacacaagttttcttcagtgctgcggggattcctagac
ctgatgttggtgagggagccctctcaaagagccacagcccaggaactcctcggacatcca
ttcttgaaactggcagggccaccatcttgcatcgttcccctcatgagacaatataggcat
cattga

KEGG   Loxodonta africana (African savanna elephant): 100668003
Entry
100668003         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase PAK 1-like
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04360  Axon guidance
lav04392  Hippo signaling pathway - multiple species
lav04510  Focal adhesion
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04810  Regulation of actin cytoskeleton
lav05132  Salmonella infection
lav05170  Human immunodeficiency virus 1 infection
lav05205  Proteoglycans in cancer
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100668003
   04012 ErbB signaling pathway
    100668003
   04014 Ras signaling pathway
    100668003
   04392 Hippo signaling pathway - multiple species
    100668003
   04024 cAMP signaling pathway
    100668003
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100668003
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100668003
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100668003
   04650 Natural killer cell mediated cytotoxicity
    100668003
   04660 T cell receptor signaling pathway
    100668003
   04666 Fc gamma R-mediated phagocytosis
    100668003
   04062 Chemokine signaling pathway
    100668003
  09158 Development and regeneration
   04360 Axon guidance
    100668003
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100668003
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100668003
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100668003
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100668003
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100668003
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100668003
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100668003
 Endocytosis
  Macropinocytosis
   Kinases
    100668003
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100668003
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 100668003
NCBI-ProteinID: XP_010596470
LinkDB
Position
Unknown
AA seq 545 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKLAEDYNSSNTLVNVKAVSETPAVPPVSEDEDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPIPVTPTRDVATSPISPTENNIIPSEALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQXPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagataaacccccagcccctccgatgagaaacacc
agcactatgattggagctggcagcaaagatgctggaaccctaaaccacggttccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggaacggccagagatttctcttccttcagat
tttgagcacacaattcatgttggttttgatgccgtcacaggggagttcacggggatgccg
gagcagtgggcccgcttgcttcagacgtcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctagatgtgttggaattttacaactcaaagaagacttccaatagccag
aagtacatgagttttacagataaattagctgaggattataattcttcaaatactttggtg
aatgtaaaggctgtgtctgagacaccagcagtgccaccagtttcagaagatgaagatgat
gatgatgatgctacccctcctccagtgattgctccacgcccagagcatacaaaatctgta
tacacaaggtccgtgattgagccaattcctgttactccaactcgggatgtggctacatct
cccatatcacctactgagaataacatcattccatcagaggctctgacccggaataccgag
aagcagaagaagaagcctaaaatgtctgatgaagagatcttggagaaattacggagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtatactgcaatggatgtggccacaggacaggaggtggccattaagcag
atgaaccttcagcaacagccgaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaatattgtgaactacttggacagttacctcgtgggagatgagcta
tgggttgtcatggaatacttggctggaggctctctgacagatgtagtgacagaaacctgc
atggatgaaggccagattgcagctgtctgccgtgagtgcctgcaggccctggagtttcta
cattcgaaccaggtcattcacagagacatcaagagtgacaacatcctgttgggaatggat
ggctctgtcaagctaactgattttggattctgtgcccagatcaccccagagcagagcaaa
cggagcaccatggtgggaaccccatactggatggcaccagaggttgtgacgcgaaaggcc
tatgggcccaaggttgacatctggtccttgggcatcatggccattgaaatgattgaaggg
gagcccccatatctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagagcttcagnaaccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtcttgaaatggacgtggagaagagaggttcagcaaaagagctactacagcatcagttt
ctgaagattgccaagcccctctccagcctcactccactgattgctgcagcaaaggaggca
accaagaacaatcattaa

KEGG   Loxodonta africana (African savanna elephant): 100668837
Entry
100668837         CDS       T04351                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04660  T cell receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05132  Salmonella infection
lav05170  Human immunodeficiency virus 1 infection
lav05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100668837 (PAK3)
   04014 Ras signaling pathway
    100668837 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100668837 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100668837 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100668837 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    100668837 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100668837 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100668837 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100668837 (PAK3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100668837 (PAK3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE20 family
   100668837 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like DSHCT APH Ribosomal_60s Kdo Spt5_N
Other DBs
NCBI-GeneID: 100668837
NCBI-ProteinID: XP_003414848
LinkDB
Position
Unknown
AA seq 544 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEE
EEDDNEPPPVIAPRPEHTKSIYTRSVVESIALPAAPNKEVTPPSAENANSSTLYRNTDRQ
RKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMN
LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMD
EGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRS
TMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTP
ELQNPERLSTVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIK
NSSR
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctgacggcctggataatgaagagaaacccccagctcccccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagagcgcccagagatttctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactggaattcctgaacaatgggcacga
ttactccaaacctccaacataacaaaactggaacagaagaagaacccacaagctgttcta
gatgttctcaaattctatgattccaaagaaacagttaacaaccagaaatacatgagcttt
acatcaggagataaaagtgcacacggatacatagcagcccatccttcgagtacaaaaaca
gcatcagagcctcctctggctcctcctgtgtctgaagaagaagatgaagaagaggaagaa
gaagaagacgacaatgaacctccaccagttattgcacctagaccagagcatacaaaatcg
atctatactcgttccgtggttgaatccattgctttgccagcagcaccaaataaagaggtg
acaccaccttctgctgagaatgccaattccagtactttgtacaggaacacagatcggcaa
aggaaaaaatccaagatgacagatgaggagatcctagagaagctaagaagcattgtgagt
gttggtgacccaaagaaaaaatacacgagatttgagaaaattggtcaaggggcatcaggt
actgtttatacagcactagacattgcaacaggacaagaggtggccataaagcagatgaac
cttcaacagcagcccaaaaaggaattaattattaatgaaattctggtcatgagggaaaat
aagaaccccaatattgttaattacttagatagctatttagtgggtgatgaactatgggta
gtcatggaatacttggctggtggctctttgactgatgtggtcacggagacctgtatggat
gaaggacagatagcagctgtctgcagagagtgcctccaagcattggatttcttgcactca
aaccaagtgatccacagagacataaagagtgataatattctcctcgggatggatggctct
gttaaattgactgattttgggttctgtgcccagatcacgcctgagcaaagtaaacgaagc
accatggtgggaaccccctattggatggcacctgaggtggtaactcgaaaagcttatggt
ccgaaagttgatatctggtctctggggattatggcaattgaaatggtggaaggcgaaccc
ccttaccttaatgaaaatccactcagggcattatatctgatagccactaacggaacccca
gagctccagaatcctgagagactgtcgactgtattccgtgactttttgaatcgctgtctt
gagatggatgtggataggcgaggatctgccaaggagcttttacagcatccatttttaaaa
ttagccaagcctctctccagcctgactcctctgattatcgctgcaaaggaagcgattaag
aacagcagccgctag

DBGET integrated database retrieval system