KEGG   Loxodonta africana (African savanna elephant): 100660963
Entry
100660963         CDS       T04351                                 

Definition
(RefSeq) steroid 17-alpha-hydroxylase/17,20 lyase
  KO
K00512  steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone deacetylase [EC:1.14.14.19 1.14.14.32]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00140  Steroid hormone biosynthesis
lav01100  Metabolic pathways
lav04913  Ovarian steroidogenesis
lav04917  Prolactin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Module
lav_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
lav_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100660963
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100660963
   04917 Prolactin signaling pathway
    100660963
   04927 Cortisol synthesis and secretion
    100660963
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100660963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lav00199]
    100660963
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.19  steroid 17alpha-monooxygenase
     100660963
    1.14.14.32  17alpha-hydroxyprogesterone deacetylase
     100660963
Cytochrome P450 [BR:lav00199]
 Cytochrome P450, animal type
  CYP17 family
   100660963
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100660963
NCBI-ProteinID: XP_003409011
UniProt: G3SPQ2
LinkDB
Position
Unknown
AA seq 508 aa
MWELLAVLLLTLVYYFWPKIRRPGAKYPKSLPFLPLVGSLPFLPRHGHPHINFFKLQKKY
GPIYSFRLGTATYVVVGQYQLAREVLIKKGREFSGRPNVLTLAMVSNNQKGVAFADSGPH
WQLHRKLVQAAFTLFKDGHQRLEKIILKEISSLCDFLANQNGQSIDISLPVFLAVTNMIS
MFCFNSSYTYDDPDLHVIKMYNEIILENLDTHSLVDIFPCLKIFPFKSLQMMKNAVKIRS
ELMHKTIEEYKEKFSSDSITNLLDILIQAKMSSDNNNDGPDQDSKMLSQEHIIATMMDIF
GAGVETTTSVMKWTVAFLLHNPQVKKKIQEEIDQNIGFSRTPTLSDRNHLVLLEATIREV
LRIRPIAPLLTPHMASTDSSIGEFTIDKGTNVIINLWALHHSEKEWHQPDQFMPERFLDP
TGCQLISPTLSYLPFGAGPRSCLGEILARQELFLFLSWVLQRFDLEVPDDGQLPSLEGNP
KAVFLISNFKVKVKVREAWREAHAEGSA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtgggagctcttggctgtcttgctgctcaccctagtttattacttttggcccaagata
aggcgccctggtgccaagtaccccaagagcctcccgttcctgcccctggtgggcagcctg
cctttcctccctcgacatggacatcctcacatcaatttcttcaagctgcagaaaaaatat
ggccccatctattcttttcgtctgggtaccgcaacttatgtggttgtcggccagtaccag
ctggccagggaggtgctcatcaagaaaggcagagaattctccgggcgacccaatgtgcta
actctggcaatggtgtcaaacaaccaaaaaggcgtcgcctttgccgacagtggtccccac
tggcagctacatagaaagctggtgcaggctgcgtttaccctgttcaaggacggccaccag
aggctagagaagatcatacttaaggaaatcagctcattatgtgatttcctggccaaccag
aatggacagtctatagatatatcgttacctgtcttcctggctgtgaccaacatgatctcc
atgttctgcttcaactcttcctacacgtatgatgatcctgatctgcatgtcataaaaatg
tacaatgaaatcatcctggagaatctggacacccacagtctggtggatatcttcccctgc
ttgaagattttccccttcaaatccctgcaaatgatgaagaatgctgttaaaatacgaagt
gaactgatgcataaaaccatagaagaatacaaggagaaattcagcagtgactctatcact
aacctgctagacatactgatccaagccaagatgagctcagacaataacaatgatggccca
gaccaggattcaaagatgctttctcaagaacacattattgccaccatgatggacatcttc
ggggctggtgtggagaccactacctctgtgatgaagtggactgtggccttcctgctgcac
aaccctcaggtgaagaaaaagatccaggaggagattgaccagaacataggttttagtcgc
acaccaactctgagtgaccggaaccacctcgttctgctggaggccaccatccgagaggtg
ctacgcatccgacctatagctcccctcctcaccccccacatggcttccactgactccagc
attggtgagtttaccattgacaaaggcacaaatgttatcatcaatttgtgggcactgcat
cacagtgagaaggagtggcaccagccggaccagttcatgcctgagcgcttcttggaccca
accgggtgccagctcatctcaccaacattgagctacttgccctttggggcgggaccccgc
tcctgcctaggtgagatcctggcccgccaggagctcttcctcttcctgtcctgggtgctc
cagaggtttgacctggaggtgccggatgatgggcagctaccctccttggagggcaatccc
aaggcggtctttctgatcagcaacttcaaagtgaaggtcaaggtgcgcgaggcctggagg
gaagcccatgctgagggtagtgcctag

DBGET integrated database retrieval system