KEGG   Loxodonta africana (African savanna elephant): 100660968
Entry
100660968         CDS       T04351                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C, slow skeletal and cardiac muscles isoform X1
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100660968 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100660968 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    100660968 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100660968 (TNNC1)
   05414 Dilated cardiomyopathy
    100660968 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100660968 (TNNC1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     100660968 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EMG1
Other DBs
NCBI-GeneID: 100660968
NCBI-ProteinID: XP_023403852
LinkDB
Position
Unknown
AA seq 126 aa
MRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMF
DKNADGYIDLEELKIMLQATGEIITEDDIEELMKDGDKNNDGRIDYDGEHMGRLDPVCSP
LPGPHF
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaggatgctgggccagaaccccacacctgaggagcttcaggagatgattgatgaggtg
gacgaagacggcagtggcacagtggacttcgatgaattcttggtcatgatggttcggtgc
atgaaggacgacagcaaaggaaagtccgaggaggagctgtctgacctcttccgcatgttt
gacaagaatgcagatggctacattgacctggaggagctgaagataatgctgcaggccaca
ggcgagatcatcacagaggatgacattgaggagctcatgaaggatggtgataagaacaat
gatggccgcatcgactatgacggtgagcacatgggtagactggaccctgtctgctcaccc
cttccaggcccccacttctga

DBGET integrated database retrieval system