KEGG   Loxodonta africana (African savanna elephant): 100660994
Entry
100660994         CDS       T04351                                 

Gene name
SERPINE1
Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04066  HIF-1 signaling pathway
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav04371  Apelin signaling pathway
lav04390  Hippo signaling pathway
lav04610  Complement and coagulation cascades
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100660994 (SERPINE1)
   04371 Apelin signaling pathway
    100660994 (SERPINE1)
   04066 HIF-1 signaling pathway
    100660994 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100660994 (SERPINE1)
   04218 Cellular senescence
    100660994 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100660994 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100660994 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100660994 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100660994 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100660994 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100660994 (SERPINE1)
Peptidases and inhibitors [BR:lav01002]
 Peptidase inhibitors
  Family I4: serpin family
   100660994 (SERPINE1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100660994 (SERPINE1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100660994 (SERPINE1)
SSDB
Motif
Pfam: Serpin Toxin_ToxA
Other DBs
NCBI-GeneID: 100660994
NCBI-ProteinID: XP_003416577
UniProt: G3T7G7
LinkDB
Position
Unknown
AA seq 400 aa
MQRSPAIVCLALGLALIFGEGSPSPESQVAHLATNFGVKVFQQVVQASKDRNVIFSPYGV
SSVLAMLQLTTGGNTQQQLHTAMQFKIDEKGMAPALRQLYKEIMGPWNKDEISTADAIFV
QRDLKLVQGFMPHFFRLFRSTVKQVNFTEVEKARFIINDWVKTHTRGMISNLLGKGAVDQ
LTRLVLVNALYFNGQWKMPFPASGTHHRLFHKSDGSTVSVSMMAQTNKFNYSEFSTPDGH
DYDVLELPYHGNTISMFIAAPYEKEVPLSALTNILDAQLISQWKGNMTRLLRLLILPKFS
LESEVDLRRPLENLGMTDIFRPDQADFTNLSDQEHLYVSQALQKVKIEVNESGTVASSST
AVVASARMVPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgcagaggtctccagccattgtctgcctcgccttgggcctggccctcatctttggagaa
gggtccccttcgcctgagtcccaggtagcccatctggccacaaactttggtgtgaaggtg
tttcagcaagtggtacaggcctctaaggaccgcaatgtgattttctcaccctatggggta
tcgtcagtactggccatgctgcagctgacaacaggagggaacacccagcaacaactccac
acagcaatgcaattcaagattgacgagaaaggcatggctcctgccctccgtcagctgtac
aaggagatcatggggccatggaacaaggacgagatcagcacagctgatgccatctttgtc
cagcgggacctgaagctggtccagggcttcatgccccacttcttcaggctgttccgaagc
acagtcaagcaggtgaactttacagaggtggaaaaagcgaggttcatcatcaatgactgg
gtgaagactcacacaagaggcatgatcagcaacttacttggcaaaggggctgtggaccag
ctgacgcgcctggtactggtgaatgccctctactttaatggccagtggaagatgcccttc
ccagcctcaggtacccaccaccgcctcttccacaagtccgatggcagcaccgtctctgtg
tccatgatggctcagaccaacaagttcaactacagtgagttttccacccctgatggtcat
gactacgacgtcctggaattgccctaccatggaaacactatcagcatgttcattgctgct
ccctatgaaaaagaggtgcctctctctgccctcaccaacatcctggatgcccagcttatc
agccagtggaaaggaaatatgaccagactgctccgcctcctgattctacccaaattctcc
ctggagagtgaagtggacctcaggaggcccttggagaacttggggatgaccgatatcttc
aggccagaccaggcagacttcacaaatctttcagatcaagagcatctctacgtgtcgcag
gcactgcagaaagtcaagattgaggtgaatgagagtggcacggtggcatcctcatccaca
gctgttgtggcctcggcccgaatggtccccgaagagatcatcatggacagacccttcctc
tttgtggttcggcataaccccacaggaacagtcttattcatgggtcaagtgatggaaccc
tga

DBGET integrated database retrieval system