KEGG   Loxodonta africana (African savanna elephant): 100661007Help
Entry
100661007         CDS       T04351                                 

Gene name
MGAM2
Definition
(RefSeq) LOW QUALITY PROTEIN: putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00052  Galactose metabolism
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100661007 (MGAM2)
   00500 Starch and sucrose metabolism
    100661007 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100661007 (MGAM2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100661007 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100661007 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100661007
NCBI-ProteinID: XP_023394913
LinkDB All DBs
Position
Unknown
AA seq 2685 aa AA seqDB search
MARKLSMLEVLLIVFIVIVLLIAVFLLILVLEEDQDSFVPDCPAIPESERIDCAPGQVVT
QEVCSWQRRCCWNPVEDTNVPRCFFPKNWGYEVSTILWNKSEEFAAQLKRLPSPTLFGND
VSDTLFTAEYQTSNRFHFKITDLNNRRHEVQHESINSLTQTVNISDFNYQVDVTEKPFSI
KIMRASNGKVLLDTGIGPLEFAQQYLQLSFHLPSTNVYGLGEHVHQQYRHDMNWKTWPIF
TRDASPTEGINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTIGGVLD
FYVFLGSTPEQVVQEYLELVGKPFLPSYWSLGFQLSRRNYGGIEGLKNVVSRNRAAGIPY
DVQYSDIDYMDGYKDFTYDNRTFYGLPDFAKELHSNGQKYVIVMNPGISNSSGYKPYEDG
KTKRIWVYENDVFAFGKGYPGWTIFPDFSNPASFTWWEEQFNKFHETLEFDGVWIEMDEV
SNLLNGSDVGCELNSLNYPPFTPRVLDRVLFERTLCMDTEFYSGLHYDLHSLYGYSMAQA
TDSAMRTVFPQKRSLVLSRSTFAGSGKFAAHWLGENTASWNDLRWSIPSILEFNLFGIPM
VGANICGYKEDTTESLCRRWMQLGAFYPLSRNHNGPGFMDQDPASFGADSLLLNSSRHYL
NIRYTLLPYLYTLFYRAHTRGDTVARPLLHEFYQDSATWDVHEQFLWGPALLITPVLHSD
VDQVNAYIPDAIWYDYDTGVAIQWRKQWVQMQFPKDKIGLHLRGGYIFPTQKPNTTTEAS
RKNSLGLIIALDHKREANGELYWDDGVSTDAVTKENYLLYDFSVASNRLQAKIINNYTNP
DNLQFTDIRILGMDKEPANFTVIVNNVHTLCSNCSNVAYSASAKVVTITDLEGLVLGQEF
SIEWTLPVSDLEKFNCYPEDPSASEESCKQRGCLWELTDVPGVPSCYYDTIPSYAASNIQ
YLPTGITTDLTVLPESLNLPPAASARQLPWAPAADPLSARIDILQLSVIYHTESMLQFKI
YNSANKRYEVPVPLNTPATPVGSPEQRLYVVSVQTNPFGIQIRRRSSNTVIWDSQLPGFT
FNDTFLSISTRLPSQYVYGFGETEHESFRRNMSWNTWGMFARDEPPGYKKNSYGVHPYYM
ALEEDGSAHGVLLLNSNAMDVTIQPTPALTYRTTGGILDFYVVLGPTPELVTQQYTELIG
RPVMTPYWALGFQLSRYGYYSDTEISNLYDAMVAAQIPYDVQHVDMDYTERKLDFTLSPM
FKDLAHLVDQMKENGMRFIPILDPAISGNETGYLPFTRGQANDVFIKWPGSNDIVWGKAW
PDLPNVSVNGSLDQETQVKLYRAHVAFPDFFRNSTVAWWKKEIQELYXKPREPENSLKFD
GLWLNHQPSNLSAGSQXMCKSRHCGNNXNLPSALESRDAGLSNGTLCMESQQVLADGSLV
RHYDVHSLYGWAQARPTYEAVQEVTGQRGLIITRSTFPSSGRWAGHWLGDNTAAWDQLRK
SIIGMMEFSLFGMSYTGANICGFFGNADYEMCLRWMQLGAFYPFSRNHNTVGTRRQDPVS
WDATFENISRSALQTRYTLLPYLYTLMHKAHVEGSTVVRPLLNEFADDVTTWEIDRQFML
GPAILISPVLESGAFAISAYFPRARWYDYSSESGEDSAGKWKTLAAPLDHINLHVRGGYI
LPWQEPAMNTHYSRQNFMGLTVALDSDRKAYGQMFWDDGQSIDTYENGNYFLANFTAAQD
NLQIQTIHNNYLSDSNPLKVGYIRIWGMKSAYVTEVKITHDNQQFTETNFRSDPYSQTLT
IQLTDKIIHLEKLTEVTWIHGDPVVTTPTMTSTFLTSSHSSPSTTEATTYETINTSSAGT
SSDAPSTSITVLITTTPALTTATTVSTSTVVPIITTPSPTSNTEDSTSTTVLMTPSPTST
TGVITSTTLLIPTTPFPTSTDAPSTSTTVHNTTTPFLTSTTDVGTSTAILIKTTPSPIST
VDASTDTTVSNTTSPFLTSTTDASTNTTISSTTIPSPTSTTDASTNATVSNMTIPSLIND
TDVVSSTAILITTTPSPTSIVAANTDTTVSNTTSPFLTSTTDASTNSTISNTITPSPTST
GASSTSTTVPNTTIPFLTSTTDVGTNTAIPITITPSSTSDTTVPNAATSSPTSTTDASTN
TTISNTNTPSLINTIDVSASTAILITTTPSPTSTTDASIDTTILITTTLSPTNTADSSTS
TTLSTTTPSPTSTTDASIDTTVPISTTSSLESNTGASTDTTLLITTTLSPTNTADSTTLS
NTATPSPTSTTDASINTTVHNVTIPSLINPTDVSTDTTVSKTTPSPSSTADVSTNFTVSN
TNTSSLTILSPFPTSNTLTTGIITNFTTPTKENTTHFNTLDTQSTVIKDATAAATSTTKS
TTSPVTMVTSTDKFTAYTKPAVTDFISSSFPEGTTASSLSTTYTEITTHALTSTNLDNGT
SATTTNSISSPTTNRITTGTPQSTDTTVAAAAATDTPFSTTQSSFSFPTAGLINTTTTDV
RTTTMDPTLVTTSHSAAATIQASSPTASTSTNFPNPGPIKTTTASTTATTVDSVTTGIIN
TPPAGNTNAATVIPTVTVTTNATSKEATSQGVSASPPQGTSGITTTKDTPPTALTGNITT
THPPNTPTHRLTLQTTMDASATASNYTANALNAKRVPRSLLLKAV
NT seq 8058 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaagctcagcatgttggaagtcctgctgatcgtcttcatcgtaattgtattg
ctcatagctgtatttttactcattcttgtgttggaggaagatcaagattcatttgttcca
gactgcccggcaatccctgaatcagaaaggatagactgtgctcctggccaggtggtgacc
caggaagtctgtagctggcagcgacggtgctgctggaaccctgtggaggacaccaatgtc
cccaggtgcttctttcccaagaactggggctatgaagtcagcacgattctctggaacaaa
agtgaagagtttgctgcccagttgaaaaggctgccatccccaaccctgtttggaaatgat
gtcagcgacaccctcttcacagctgaatatcagacatccaatcgttttcattttaagatc
accgacctcaataacagacgacatgaagtccaacatgaaagtattaactcactgactcag
actgttaatatctctgatttcaactatcaagtggatgtcactgagaagcccttcagcatc
aaaataatgagggcaagcaatggaaaagtcttgttggacacgggcattgggcccctcgag
tttgcccaacagtacctgcagctgtcttttcacctgcccagcaccaacgtgtacgggctg
ggggaacacgtgcaccagcagtatcgccatgacatgaactggaagacctggcccatcttc
actcgggatgcctctcccaccgagggcattaatctatacggggctcataccttcttcttg
tgcctggaagacaccagcggctcctcgttcggggtttttctgttgaacagtaacgccatg
gaggtcacccttcagcctgctcccgcaatcacctaccgcacgattgggggtgttcttgac
ttttacgtgttcctgggaagcactccagagcaggtcgttcaggaatacctggagcttgtt
ggaaaaccattcttgccttcctactggagtcttgggttccagcttagtcgcaggaattat
ggtggcatcgaaggactgaagaatgttgtgagtcgaaaccgtgcagctgggatcccgtat
gatgtgcagtactctgacatagactacatggatggatacaaggatttcacttatgataac
aggactttctatggtctcccagatttcgccaaggagttacacagcaatggacagaaatat
gtcattgttatgaatcccggcatctccaacagctctggctataagccctacgaggatgga
aaaacaaagaggatatgggtctacgagaatgatgtatttgcttttgggaagggctatcct
gggtggacaatctttcctgatttcagtaatccagcgagctttacctggtgggaagaacag
ttcaataaattccatgaaactctggagtttgatggagtgtggattgaaatggatgaagtt
tctaatcttcttaatggctctgatgttgggtgtgaattaaacagcttgaactatcctcct
ttcacgcctagagttctggaccgggtgcttttcgagagaaccctttgcatggacacagag
ttttacagtggccttcactatgacctccacagtttgtatggctactccatggcacaagcc
acagactcggccatgcggactgtcttcccccaaaaacggagcctcgtcttatcccgctct
acttttgctgggtctggcaagtttgctgctcactggttgggggaaaacacagcctcatgg
aatgatctccggtggtccattcccagtatccttgagttcaacctatttggcatccccatg
gtaggtgccaatatctgtggttataaagaagataccacagagagcctctgcagaagatgg
atgcagcttggagcattttatccactatccaggaatcacaatgggcctggcttcatggac
caggaccctgcctcctttggagccgactccctgctgctcaactcttccaggcactacctg
aacatcagatacaccttgctgccctacctgtacaccctcttctaccgcgcgcacacccgt
ggggacacggtggcccggcccctgctgcatgagttctaccaggattcagccacctgggat
gtgcacgagcagttcctatgggggcctgcactcctgatcacacctgttttacactcagat
gtagaccaagtgaatgcctacatcccggatgctatctggtatgactatgacacaggagtg
gccatccaatggaggaaacaatgggtgcagatgcaattccccaaagataaaataggactt
caccttcgagggggctacatattccctacccagaagccaaacacaaccacagaggccagc
cggaagaattccctgggacttatcattgccctggatcacaagagggaagctaatggggag
ctgtactgggatgatggcgtgtccacagatgctgtgaccaaagagaactatctcctgtat
gacttctctgtggcctctaaccgtctacaggcaaagattataaataattatacgaaccct
gacaacctgcaatttacagatatcagaatcttgggaatggacaaggagccggctaatttt
actgtcatagttaataatgttcacaccctctgttcaaactgttcaaacgttgcctacagt
gcctcagcaaaggtggtaaccatcactgaccttgaggggctggtactgggacaagagttc
tccattgagtggacgcttcccgtcagtgacctggagaagttcaattgctaccctgaggat
ccctctgcttcggaagagagctgcaagcagcgggggtgcctgtgggagctcacagatgtc
cctggagtgccctcctgttactatgacaccatccccagctatgctgccagtaatatccag
tacctgcccacgggcatcaccacggacctcactgtcctgccagaatccctgaatctccct
ccagcagcgagtgcgcgccaattgccctgggcccccgctgctgatcctctctctgccagg
attgacatcctccaactgagtgtgatctaccacacagagagcatgctgcagttcaagatc
tacaattctgccaacaagaggtacgaggtcccagtgcccctcaacaccccagccacccca
gtgggctcccctgagcagcgtctgtatgttgtcagcgtccagaccaatccttttgggatc
cagattcgacggagaagctccaacaccgtgatctgggactctcagctccctggcttcacc
ttcaacgacacgttcctctccatctcaactcgcttgccctcccagtacgtttacggcttt
ggggaaacagagcatgaaagtttcagaagaaacatgagctggaatacatggggaatgttt
gctcgagatgaacccccagggtacaagaagaactcctatggtgtgcacccctactacatg
gcactagaggaggacggcagtgcccacggagtgctcctgctcaacagcaatgccatggat
gtgaccatccagcccacccctgccctgacataccgcaccacaggagggattttggacttt
tatgtggttttggggccaacccctgaacttgtaactcagcagtacactgagctgattggc
cggccagtgatgactccatactgggccttgggattccagctgagtcgctatggatactac
agtgatacggagatctccaatttgtatgatgcgatggtggcagcccagatcccctacgat
gtacaacacgttgacatggactacacggagcggaagctggacttcaccctcagccccatg
ttcaaagacctcgcccacctggttgaccaaatgaaggaaaatggcatgagatttattccc
attttggacccagccatttctggcaatgagaccgggtatctccctttcaccaggggacag
gcaaacgacgtgttcatcaaatggcctggcagcaatgacattgtctgggggaaggcatgg
ccggatctgcccaacgttagcgtgaatgggtccctggaccaggagactcaggtgaagctg
tacagggcccacgtggcatttcctgacttctttcgcaacagcacagttgcatggtggaag
aaagaaattcaagagctctatngaaaacctcgagagccagagaacagcttgaagtttgat
gggctgtggcttaaccaccaaccttccaacctttctgctggcagtcaatgaatgtgcaag
tcgcgtcactgcggtaataactaaaatctcccctcagctctggagtccagggacgcaggc
ctgagcaacgggacgctgtgcatggagagccagcaggtgctggcagacggctccctggtg
cggcactatgacgtgcacagcctgtacggctgggcccaggccaggcccacctacgaagct
gtgcaagaggtgacagggcagcgaggccttatcatcacccgctccaccttcccctcctct
ggccgctgggcaggacactggctgggagacaacacggccgcgtgggaccagctgaggaaa
tccatcatcggcatgatggagttcagcctctttgggatgtcctatacaggagccaatatc
tgtgggttctttggaaacgcggattatgagatgtgtctccgctggatgcagctgggggcc
ttctaccccttctccaggaaccacaacaccgtggggaccaggagacaagaccctgtgtcc
tgggacgccacctttgagaacatctccaggagtgccctgcagaccagatacaccctgctg
ccatacctgtacaccctgatgcacaaggcccacgtcgagggcagcaccgtcgtgcgaccc
cttctcaacgagtttgcagatgatgtcacaacctgggagatcgaccgtcaattcatgctt
ggtcctgccatcctgattagccctgtgctggaaagtggtgcctttgccatctccgcttac
ttccccagagcccgctggtatgactacagctcggaatctggtgaggattcggcaggtaag
tggaagacactggcggctccccttgaccacatcaaccttcacgtcagaggaggctacatc
ctgccctggcaagagcctgcgatgaacactcactacagtcgacaaaattttatgggactg
actgttgccttggacagtgacaggaaagcttatggccagatgttctgggatgatggacaa
agcattgatacctatgaaaatggaaactatttcttggcaaactttacagcagcacaggat
aacttgcagatccagaccatacacaataactatttgagtgactcaaatcccctgaaggtt
ggctatattaggatctgggggatgaaatctgcttatgtgacagaagtcaagatcacccat
gacaaccagcaattcacagagacaaacttcaggagtgacccttatagtcagacactaact
attcagttgactgacaagattattcacctggaaaagttaactgaggttacttggattcat
ggtgaccctgtagttactactccaactatgacaagtacctttttgacgagttctcattcc
tctccatcaactactgaggctaccacttatgagactattaacactagttctgctggtaca
agttctgatgctcctagcactagcattactgttcttattacaactactcctgccctgaca
actgctactactgttagcactagcactgttgttcctatcatcactactccttctcctaca
agtaatactgaagatagcactagtactactgttcttatgactccttccccaacaagtact
actggtgttatcactagcactactcttcttattccaactactcctttccctacaagtact
gatgctcctagcaccagtactactgttcataatacaaccactccatttctgacaagtact
actgatgttggcaccagtactgctattcttattaaaacaaccccttctcctataagtact
gtggatgcgagcactgacactactgtttctaatacaacctctccattcctgacaagtact
actgatgctagcactaacactactatctctagtacaaccattccttcccctacaagtact
actgatgctagcactaatgctactgtttctaatatgaccattccttccctgataaatgat
actgatgttgtcagtagcactgctattcttattactacaaccccttctcctacaagtatt
gtggctgctaatactgatactactgtttctaatacaacctctccattcttgacaagtaca
actgatgctagcactaacagtacgatttctaatacaattactccttctcctacaagtact
ggtgcttctagcactagtactactgttcctaatacaaccattccgttcctgacaagtact
actgatgttggcactaatactgctattcctattacgattaccccttcttctacaagtgat
actactgttcctaatgcagctacttcttcccccacaagtactactgatgctagcactaat
actactatttctaatacaaacactccttctctgataaatactattgatgttagcgcaagt
actgctattcttattacaactactccttctcctacaagtactactgatgctagcattgac
actactattcttattacaactactctttctcccacaaatactgctgattctagcactagt
actactctttctacaactactccttcccctacaagtactactgatgctagcattgacact
actgttcctattagcaccacttcttccctggaaagtaatactggtgctagcactgatact
actcttcttattacaactactctttctcccacaaatactgctgatagtactactctttct
aatacagctactccttcccctacaagtactactgatgctagcattaatactactgttcat
aatgtaaccatcccttccctgataaaccctactgatgttagcacggatactactgtttct
aagactactccttctccctcaagtactgctgatgttagcactaattttactgtttctaat
acaaatacttcttcccttacaattttgagcccctttccaacaagtaatacacttactact
ggtataattactaattttactacacctactaaagagaacaccactcatttcaacactctg
gatacacaaagtactgtgataaaggatgctacagctgctgctaccagcaccacaaaaagt
actacaagtccagttacaatggtcacttccacagacaaatttactgcatataccaaaccg
gctgtgacagattttataagctcgtcttttccagaaggaacaactgccagctccctaagc
accacgtatactgaaatcacaactcatgcattaacttccacaaatctggacaatggaacg
tccgccaccacaacaaactcaataagtagccccactacaaacaggataactactggtaca
ccacagtccacagatactaccgtcgctgcagcggctgccacggacacaccgttctctacc
acccaaagctctttttcttttcccacagcagggcttataaatactacaaccacagatgtc
agaactaccaccatggaccctacactggtcactacttcccattctgctgctgctacaata
caggcctcaagtcccacagcatcaacttccacaaattttcctaatccaggccccatcaag
acgactactgcaagcactacagctactaccgtggattcagttaccacagggattataaat
actccccctgcaggaaacacaaatgcagctacagtcatccccacagttactgtgactaca
aatgctacatctaaggaagctacttctcagggcgtttctgcttcgccacctcaaggcacc
tctggtatcaccaccacaaaagacacacctcccactgcacttactggaaatattaccact
acccatcctcccaatactcctactcatcgacttaccctccaaacaaccatggatgcttct
gctactgcctctaattatactgcaaatgccctaaatgccaaacgagtccctcgatcattg
ctactcaaagcagtataa

DBGET integrated database retrieval system