KEGG   Loxodonta africana (African savanna elephant): 100661010
Entry
100661010         CDS       T04351                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X14
  KO
K09052  cAMP response element modulator
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100661010 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100661010 (CREM)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100661010 (CREM)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf MMgT
Other DBs
NCBI-GeneID: 100661010
NCBI-ProteinID: XP_003420754
LinkDB
Position
Unknown
AA seq 142 aa
MSILLLTLHMLASLEHLMLSCDKETRHFCMQEPIMAVTREETAATGDMPTYQIRAPTTAL
PQGVVMAASPGSLHNPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLE
VQNKKLIEELETLKDICSPKTD
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtcaatacttctacttaccctgcacatgcttgctagtttggaacatttgatgttgagc
tgtgataaggaaacaagacacttctgtatgcaggagcccatcatggctgtaaccagagag
gaaacagccgccactggtgacatgccaacttaccagatccgcgctcctaccaccgctttg
ccacaaggagtagtgatggcggcctcaccaggaagtttgcacaatccccagcagctggca
gaagaggcgacgcgcaaacgagagctgaggctgatgaaaaaccgggaagctgcgaaagaa
tgtcgacgtagaaagaaagaatatgtaaaatgtctggagagtcgagttgcagtgctggaa
gttcagaacaagaagcttatagaggaacttgaaaccttgaaagacatttgctctcccaaa
acagattag

DBGET integrated database retrieval system