KEGG   Loxodonta africana (African savanna elephant): 100661026
Entry
100661026         CDS       T04351                                 

Gene name
TBK1
Definition
(RefSeq) serine/threonine-protein kinase TBK1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04014  Ras signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04657  IL-17 signaling pathway
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05135  Yersinia infection
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100661026 (TBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100661026 (TBK1)
   04137 Mitophagy - animal
    100661026 (TBK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100661026 (TBK1)
   04621 NOD-like receptor signaling pathway
    100661026 (TBK1)
   04622 RIG-I-like receptor signaling pathway
    100661026 (TBK1)
   04623 Cytosolic DNA-sensing pathway
    100661026 (TBK1)
   04657 IL-17 signaling pathway
    100661026 (TBK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100661026 (TBK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100661026 (TBK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100661026 (TBK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100661026 (TBK1)
   05161 Hepatitis B
    100661026 (TBK1)
   05160 Hepatitis C
    100661026 (TBK1)
   05171 Coronavirus disease - COVID-19
    100661026 (TBK1)
   05164 Influenza A
    100661026 (TBK1)
   05162 Measles
    100661026 (TBK1)
   05168 Herpes simplex virus 1 infection
    100661026 (TBK1)
   05163 Human cytomegalovirus infection
    100661026 (TBK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661026 (TBK1)
   05169 Epstein-Barr virus infection
    100661026 (TBK1)
   05165 Human papillomavirus infection
    100661026 (TBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100661026 (TBK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100661026 (TBK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100661026 (TBK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100661026 (TBK1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    100661026 (TBK1)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal DUF713 CEP63 Kinase-like
Other DBs
NCBI-GeneID: 100661026
NCBI-ProteinID: XP_003405226
LinkDB
Position
Unknown
AA seq 729 aa
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNVSFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYGVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRVIIHVFSLQQMTAHKIYIHSYNTATVFHELVYKQTKIISSNQEFIYEGRRLV
LEPGRLAQHFPNTSEENPIFVVSPEPLSTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYTCRISSTLLLYQELMRKGVRWLIEIIKDDYNDAVHKKTEVVITLEFCIRNIEKTVK
VYEKLMQINLEAAELGEISDIHTKLLRLSSSQGTVETSLQDIESKLSPGGLLADTWAHQE
GTHPKDRNVERLQVLLNCITEIYCQFKKDKAERRLAYNEEQIHRFDKQKLYYHATKAMTH
FADECVKKYEAFVDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQ
KMFAASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgcagagcacttctaatcatctgtggcttttatctgatattttaggccagggagctact
gcaaatgtctttcgtggaagacataagaaaactggtgatttatttgctatcaaagtattt
aataatgtaagttttcttcgaccagtggatgttcaaatgagagaatttgaagtgttaaaa
aaactcaatcacaaaaatattgttaaattatttgctattgaagaagagacaaccacaaga
cataaagtacttattatggaattttgtccatgtgggagtttatacggtgttttagaagag
ccatctaatgcctatggattgccagagtctgaatttttaattgttttgcgagatgtggtg
ggtggaatgaatcatctccgagagaacggcatagtccaccgtgatatcaagccaggaaat
atcatgcgtgttataggggaagatggacagtctgtgtataaactcacagactttggcgca
gctagagaattagaagatgatgagcagtttgtttctctgtacgggacagaagaatatttg
catcctgatatgtatgaaagagcagtgttaagaaaagatcaccagaagaaatacggagca
acagttgatctttggagcattggggtaacattttaccatgcagctactggatcactgcca
tttagaccatttgaagggcctcgtaggaataaggaagtgatgtataaaataattactgga
aagccttctggtgcaatatctggagtgcagaaagcagaaaatggaccaattgactggagt
ggagacatgcctgtctcttgtagtctttctaggggtctgcaagttctacttacccctgtt
cttgcaaacatccttgaggcagatcaggaaaagtgttggggttttgatcagttttttgca
gaaactagtgatatacttcaccgagtgataattcatgttttttcgctacaacaaatgaca
gctcataagatttatattcacagctataatactgctactgtatttcatgaactggtatat
aaacaaaccaaaattatttcttcaaatcaagaatttatctatgaaggacgacgcttagtt
ctagaacctggaaggctggcacagcatttccctaacacttctgaggaaaatcctatcttt
gtagtaagcccggaacctctgagcaccataggattaatatatgaaaaaatttctcttcct
aaagtgcacccacgttatgatttagatggggatgctagcatggctaaggcaataacaggg
gttgtgtgttacacctgtagaatctccagcaccctactgctttaccaggaattaatgcga
aagggagttcggtggttgattgaaataattaaagatgactataatgacgctgttcataaa
aagacagaagtcgtgatcacattggaattctgcatcagaaatattgaaaaaactgtaaaa
gtatatgagaagttgatgcagatcaacttagaagcagcagagctaggtgaaatctcagat
atacacaccaaattgttgagactttccagttctcagggaacagtagaaaccagtcttcag
gatatcgaaagcaaattgtctccaggtggattgctggcagatacatgggcacatcaagaa
ggcactcatccaaaagacagaaatgtagaaaggctacaagtcctgttaaattgcatcaca
gagatatactgtcaattcaaaaaagacaaagcagaacgtaggctagcttataatgaagaa
caaattcacagatttgataagcaaaaactgtattaccatgcaacaaaagctatgacccac
tttgcggatgaatgtgttaaaaagtatgaagcatttgtggataagtcagaagaatggatg
agaaagatgctccatttaaggaaacagttgttatctctaactaatcagtgttttgatatt
gaagaagaagtatcaaagtatcaggactacactaatgagttacaagaaactttgcctcag
aaaatgtttgcagcctccagtggaatcaaacataccatgaccccaatttatccaagttct
aacacattagtggaaatgactcttggtatgaagaaattaaaggaagagatggaaggtgtg
gttaaagaacttgctgaaaataatcatattttagaaaggtttggctctttgaccatggat
ggtggccttcggaatgttgactgtctttaa

DBGET integrated database retrieval system