KEGG   Loxodonta africana (African savanna elephant): 100661041
Entry
100661041         CDS       T04351                                 

Gene name
PTGIR
Definition
(RefSeq) LOW QUALITY PROTEIN: prostacyclin receptor
  KO
K04263  prostacyclin receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04270  Vascular smooth muscle contraction
lav04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100661041 (PTGIR)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100661041 (PTGIR)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100661041 (PTGIR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100661041 (PTGIR)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Lipid
   Prostacyclin
    100661041 (PTGIR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100661041
NCBI-ProteinID: XP_003406748
LinkDB
Position
Unknown
AA seq 386 aa
MADSCRNLTYVRGSVGPATSTLMFLAGVVGNGLALGILGARRRSRPSAFAVLVTGLAGTD
LLGTCFLSPAVFVAYARNSSLLGLARGGPALCNAFAFAMTFFGLASTLILFAMAVERCLA
LSHPYLYAQLDGPRCARLALPAIYAFCTLFCSLPLLGLGRHQQYCPGSWCFIRMRSNELG
GCAFSLAYASLVALLVAAIVFCNGSVTLSLCRMYRQQRRHQGPLVPRLRAGEDEVDYLIL
LALMTGIMAVCSLPLTIRGFTQAIAPDSSEMGDLRAFRFNAFNPILDPWVFILFRKAVFQ
RLWLWLCCLGRGSARGDLQMSLALPDSTSRRKDLSFPPALGGKEGSWVPLSAWGEGRVAP
SPPAQVPGSTVGPPCKAESTVACSLC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcggattcctgcaggaacctcacctatgtgcggggctcagtgggtccagccaccagc
accctgatgttcctggcgggcgtggtgggcaacgggctggccctgggcatcttgggggct
cggcggcggtcgcgcccctcggcctttgcagtgctggtcacggggctggcaggcaccgac
ctgctgggcacgtgcttcctgagcccggctgtgtttgtggcctacgcccgaaacagctca
ctgctgggcctggcccggggtggccctgcgctctgcaacgccttcgccttcgccatgacc
ttcttcggcctggcctccaccctcatccttttcgccatggctgtggagcgctgcctggcg
ctcagtcacccctacctctatgcccagctggatggaccacgctgtgcccgcctggcgctg
cctgccatctacgccttctgcaccctcttctgctcactgcccctgctgggcctgggccgc
caccagcagtactgcccgggcagctggtgtttcatccgcatgcgctcaaatgagctgggg
ggctgcgccttttcgctggcctatgccagccttgtggctctcctggtggccgccattgtc
ttctgcaatggctcggtcaccctcagcctctgccgcatgtaccgccagcagaggcgccac
caggggccactggtgcccaggctccgggcgggcgaggatgaggtggactacctgattctg
ctggccctcatgacaggcatcatggccgtgtgctccctgccactcacgatccgtggcttc
acccaggccatcgccccagacagcagtgagatgggggacctccgcgccttccgcttcaat
gccttcaaccccatcctcgacccctgggtcttcatcctcttccgcaaggctgtcttccag
cgcctctggctctggctctgctgcctgggccgagggtctgcccgtggagacttgcagatg
tcccttgccctgcctgactccacctcccggaggaaggacttgagtttcccgcctgccctg
gggggcaaggaggggagctgggtgcccttgtcagcctggggcgaggggcgggtggccccc
tcgcctcctgcgcaagtacctggaagcaccgtgggaccaccgtgcaaagcagagtccacc
gtggcctgctctctctgctga

DBGET integrated database retrieval system