KEGG   Loxodonta africana (African savanna elephant): 100661109Help
Entry
100661109         CDS       T04351                                 

Gene name
DOT1L
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00310  Lysine degradation
lav05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100661109 (DOT1L)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100661109 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100661109 (DOT1L)
Enzymes [BR:lav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100661109 (DOT1L)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100661109 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 100661109
NCBI-ProteinID: XP_023397032
LinkDB All DBs
Position
Unknown
AA seq 1774 aa AA seqDB search
MALPYKGEQQALRLPLGRVPRNHPALKLFPFVFQDKHHDAAHEIIETIRWVCEEIPDLKL
AMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPCNGLLRHILQQ
VYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQV
AAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIA
NTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRV
VELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNT
TTPTKVQESKAAVPADTPMDSGAEDEKAGATTVKKPSPSKARKKKLNKKGRKMAGRKRGR
PKKMSTANPERRPRKSQTTLDLLHTQAAPQTAPSSPQDAYKSPHSPFYQLPPAVQRHASS
PLLAAPTPPALQKLLESFKIQYLQFLAYTKTPQYKANLQLLLDQEKDQYKAASCEAEVED
VQMSTFSIISDVSLSPSHWPQHLTGRAYLELGGLLGEITPWIGVQCWGLSSALYCSVGSS
HPLPTTSVPWGGCQTRDSLQHLYPPPRQLKARCEELKLDWPTLSLEKLLKEKQALKSQIS
EKQRRCLELQISIVELEKSQRQQELLQLKSSVPADDALAVHLRGKGVLSREPEPDPGRLH
LELDCAKFSLPPFSSLSPELSMNGHAAGYELYSTLSRPASKQNTPQYLASALDQEVVPCT
PSHGGRPRLDKLASLALPDYTRLSPAKIVLRRHLSQDPAANGKVATSELHPRAEHAKENG
LTRQSPGISSSITLSPQDPQPVSPVALQMTGEKGSEKGLKERPYGSSSETITSLPVSIPL
STVQPNKLPVSIPLASVVLPSRAERVRSTPSPVHQSRDPSSTLDKQIGANPHSGASSAAG
SRGLALAPAGFSYAGSVAITGALAGSPAALAPGAEPATLDESSGSGSLLAALGSRSSTPQ
HPTLLAQARSSGPASPAHQLSASPRLGGPSQGTLSDAAGKSDLPCDAGFSDPESEAKRRI
VFTIAAGSGGARPSPSSKHSPLATSARGDGGQGHGQDSRKRGRRKRSSAGTPSLSSGVSP
KRRAPPSVAGLFTQSSGSPLNLNSMVNNINQPLEITAISSPESSLKSSPVPYQDHDQPPV
LKKEKPLGQTNGAHYSPLTSDDEQGSEDEPGSARIERKIATISLESKSPPKTLENGGGLA
SRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSPLQASSVLSQNSVFAFRPTLEESGAT
DAKGAAHPRKGFSGSLAGADGPSLNTNPPNGFALSGALAADLSLHSFSDGASLAHKAPEA
AGLSFPPQRGKEAGAPEANPFLSKRPLDGLGGLKGEASKAREAGDLGPALGSASEKAALP
PIGKAGRGRDRELDFTHGHNLFISAAAVPPGGLLSGPGLAPAVSSTGTHAPSTQTHRPFM
GNFAPGAQFALGPMSLQANLGSVAGSSVLQSLFSAVPAAAGLVHVSSAATRLTNSHAMGT
FSSGVAGGTVGGRRGAFLCRRLVASTWPWGSSGRRGAVCGSATLSLAPLHAVASTSAASF
QAPSSVETRPPPLPPAQHLGRPPPPPPPLPVQPGLPPPPPNTALPPPPPLLAPNSEPVLL
QSLASLPANHAFLPPASAASLPPANASLSVKLAALPHKASRPSFTVHRPPLPRLALAQAA
PLLPQASPAAPSAVWVSLGMPSPYAAHLSGVKPR
NT seq 5325 nt NT seq  +upstreamnt  +downstreamnt
atggcattgccatacaagggggagcagcaggctctccgactgcctctgggccgtgtaccc
cgcaaccacccggctctaaaactgtttccgtttgtttttcaggacaaacatcacgatgct
gctcacgaaatcatcgagaccatccgatgggtctgtgaagaaatcccagatctcaagctt
gccatggaaaactatgttttaattgactatgataccaaaagcttcgagagcatgcagagg
ctctgtgacaagtacaaccgggccatcgacagcatccaccagctgtggaaggggaccacg
cagcccatgaagctgaacacgcggccgtgcaatgggctcctgcggcacatcctgcagcag
gtctacaaccactcggtgaccgaccccgagaagctcaacaactacgagcccttctcgccc
gaggtgtacggcgagacctccttcgacctggtggcacagatgatcgacgagatcaagatg
accgaggacgacctgtttgtggacctgggcagcggagtgggccaggttgtgctccaggtc
gctgcagccaccaactgcaaacatcactacggcgtggagaaagctgacatcccagccaag
tacgcggagacgatggacagagagttcaggaagtggatgaaatggtatggaaaaaagcat
gccgaatacacactggaaagaggcgatttcctctcagaagagtggcgtgagcggattgcg
aacacgagtgttatatttgtgaataactttgcctttggtcctgaggtggatcaccagctg
aaggagcgatttgcaaacatgaaggaaggtggcagaatcgtgtcctcaaaaccctttgca
cctctaaacttcagaataaacagtagaaacttgagcgatatcggcaccatcatgcgcgtc
gtggagctgtcgcccctgaagggctcagtctcgtggacggggaagccggtctcctactac
ctgcacactatcgaccgaaccatacttgaaaactatttttctagtctgaaaaatccaaaa
ctcagggaggaacaagaggcagctaggcgtcggcagcaacgcgaaaacaagagcaacacg
accactccaaccaaggtccaggagagcaaggcggccgtccctgcggacacccccatggac
tctggtgctgaggacgagaaagccggggccaccactgtcaaaaagccatccccctcgaaa
gcccgcaagaagaagctgaacaagaagggccggaagatggccggccggaagcgtgggcgt
cccaagaagatgagcactgcgaaccccgagcgcaggcccaggaagagccaaaccacactg
gacctcctgcacacgcaggctgcgccccagaccgccccgtcctcgcctcaggatgcgtac
aagtcacctcacagcccgttctaccagctacctccggccgtgcagcggcacgcgtccagc
ccgctgctggcggcgcccaccccgcccgcgctacagaagctgctagagtctttcaagatc
cagtacctgcagttcttggcatacaccaagaccccgcagtacaaggccaacctgcagctg
ctgctggaccaggagaaggatcagtacaaagctgcttcctgcgaggcggaagttgaagat
gtccaaatgtccaccttctccatcatctctgacgtcagcctctccccctcgcattggcca
cagcatctcacaggacgcgcgtacttagagttaggtggtttactgggggagataaccccc
tggatcggagtgcagtgctgggggctgtcctctgcgctgtactgcagcgtgggctcctcc
catcctctcccaaccacgagtgtgccctggggagggtgccagaccagggactcactgcag
cacttgtaccccccgccccggcagcttaaggcacggtgtgaggagctgaagctggactgg
cccaccctgtccctggagaagctgctgaaggagaagcaggccctgaagagccagatctct
gagaaacagaggcgctgcctggagctgcagatcagcatcgtggagctggagaagagccag
cggcagcaggagctgctacagctcaagtcctccgtgccagcggacgacgccctggctgtg
cacctgcgcgggaaaggcgtgctgagccgggagccagagcctgaccctggccgcctccac
ctggagctcgactgtgccaagttctcgctgccgcccttcagcagcctgagcccggagctc
tccatgaacggccacgcggccggctacgagctgtacagcacgctcagccgacccgcgtcc
aagcagaacaccccacagtacctggcctcagccctggaccaggaggtggtgccctgtaca
cccagccatgggggccggccgcggctggacaagctggccagcctggccctgcccgactac
actcggctctctccagccaagatcgtactgaggcgtcacctgagccaggaccccgcggcc
aacggaaaggtggccaccagtgagctgcacccacgtgcggagcatgccaaggagaacggc
ctcacccgtcagagccccggcatctccagcagcatcacattgagtccgcaagaccctcag
cctgtgtcccccgtggccttacagatgacaggggagaagggcagtgagaagggcttgaag
gagcgcccctatggcagcagtagtgagaccatcaccagcctgcctgtcagcatcccgctc
agcaccgtgcagcccaacaagctcccagtcagcatccctctggccagcgtggtgttgccc
agccgtgcagagcgagtgaggagcacgccaagccccgtgcaccagagccgagacccctcc
tctacgctcgacaagcagatcggtgctaaccctcacagcggtgcgagcagtgctgccgga
agtagaggcctggccctggcccccgcaggcttctcctatgccggctcggtggccatcact
ggggccctggcgggcagcccggcagccctcgcccccggggctgagccagccaccttggac
gaatcctcgggctcaggcagcctccttgctgccctgggctcacgcagctccacaccgcag
caccccaccctactggcgcaggcccgcagctctggcccggcctctcccgcccatcagctc
tcagccagcccccggcttgggggaccttcccagggcacactctccgatgctgctggcaag
agcgacctgccctgcgatgcaggcttctcagaccctgagagcgaggccaagcgcaggatt
gttttcaccattgcagccggctcagggggtgcacggccatccccctccagcaagcacagc
cccctggccaccagcgcccgtggggacggtgggcagggccacgggcaggacagccgaaag
cgaggccgcaggaagcgctcatcggcaggcacccccagcctgagctcaggagtgtccccc
aagcgccgggccccaccatctgttgctggactcttcacacagtcctcggggtcccccctg
aacctcaactccatggtcaacaacatcaaccagcccctggagatcacggccatctcgtcc
cctgagagctccctgaagagctcgccggtcccctaccaggaccatgaccagccgcccgtg
ctcaagaaggagaagccgctgggccaaaccaatggggcacactactcgccgctgacgtcg
gacgacgagcagggctccgaggatgagcccggcagcgccagaatcgagaggaaaattgca
acaatatccttagaaagcaaatctcccccaaaaaccttagaaaatggtggtggcctggcc
agcaggaagccggcaccggccggtgagccagtcaacagcagcaagtggaagtccacattc
tcgcccatctcggacattggcctagccaagtcggccgacagcccgctgcaggccagctcc
gtgctgagccagaactccgtgtttgcgtttcggcccaccctggaggagtctggcgccacc
gatgccaagggggctgcacaccccaggaagggcttctcgggctccctggcaggggcggat
gggcccagcctgaacaccaacccccccaacgggttcgccctcagcggggccctggccgcc
gaccttagtttacacagcttcagcgatggtgcttctcttgcccacaaggcccctgaggca
gctgggctgagcttcccccctcagcggggcaaggaggctggcgccccagaggccaacccc
ttcctgagcaagcggccactggatggactgggtggcttgaagggcgaggccagcaaggcc
cgcgaggccggcgacctgggcccggccttaggcagtgcctctgagaaggctgccctgccg
cccatcgggaaggcaggccgaggccgggaccgcgagcttgacttcacccacggccataac
ctcttcatctcggctgctgctgtgccccctgggggcctcctcagcggcccgggcctggcc
ccggcagtgtcctccacgggcacccatgccccctccactcagacgcatcgccccttcatg
ggcaacttcgcccccggtgcacagttcgccctgggccccatgtccctgcaggctaacctg
ggctcagtggcaggctcatctgtgctgcagtccctgttcagtgccgtgccggccgctgca
ggcctggtgcacgtgtcatctgcggccaccaggctcaccaactcgcatgccatgggcacc
ttctcttccggagtcgcgggcggaactgtcggaggtaggcgaggcgcgtttctttgccgg
cgtcttgttgccagcacctggccttggggctcctcaggcaggcgcggggctgtctgtggc
agcgccacgctgagcttagccccgctgcatgcggtggccagcacctccgccgcttccttt
caggccccgtcctctgttgagacccggccgcccccgctgcctcctgctcagcacctgggc
cggcctcccccaccacctcctcctcttccggtgcagcctggcctcccaccccctccgcct
aacaccgccttgcctcctcccccaccgctgctggcacctaactccgagcccgtgctcctg
cagagcctggcgtccctccctgctaaccatgctttcttgccccccgcctctgctgcctcc
ctgccgcccgctaacgcctctttgtctgtcaagcttgctgccctgccacacaaggcttcc
cgcccctccttcacggtccaccgcccgcctctgccccggctggccctggcgcaggctgcg
cccctcctcccgcaggccagccccgccgcaccctccgcggtctgggtttcccttggcatg
ccgtctccttatgccgcgcacctttcgggggttaagccgcgataa

DBGET integrated database retrieval system