KEGG   Loxodonta africana (African savanna elephant): 100661112
Entry
100661112         CDS       T04351                                 

Gene name
INS
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04911  Insulin secretion
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04940  Type I diabetes mellitus
lav04950  Maturity onset diabetes of the young
lav04960  Aldosterone-regulated sodium reabsorption
lav05010  Alzheimer disease
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661112 (INS)
   04014 Ras signaling pathway
    100661112 (INS)
   04015 Rap1 signaling pathway
    100661112 (INS)
   04066 HIF-1 signaling pathway
    100661112 (INS)
   04068 FoxO signaling pathway
    100661112 (INS)
   04072 Phospholipase D signaling pathway
    100661112 (INS)
   04022 cGMP-PKG signaling pathway
    100661112 (INS)
   04151 PI3K-Akt signaling pathway
    100661112 (INS)
   04152 AMPK signaling pathway
    100661112 (INS)
   04150 mTOR signaling pathway
    100661112 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100661112 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100661112 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100661112 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100661112 (INS)
   04910 Insulin signaling pathway
    100661112 (INS)
   04923 Regulation of lipolysis in adipocytes
    100661112 (INS)
   04913 Ovarian steroidogenesis
    100661112 (INS)
   04914 Progesterone-mediated oocyte maturation
    100661112 (INS)
   04917 Prolactin signaling pathway
    100661112 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100661112 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100661112 (INS)
   04213 Longevity regulating pathway - multiple species
    100661112 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100661112 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100661112 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100661112 (INS)
   04940 Type I diabetes mellitus
    100661112 (INS)
   04950 Maturity onset diabetes of the young
    100661112 (INS)
   04932 Non-alcoholic fatty liver disease
    100661112 (INS)
   04931 Insulin resistance
    100661112 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 100661112
NCBI-ProteinID: XP_003422420
UniProt: G3TLG9
LinkDB
Position
Unknown
AA seq 105 aa
MALWTRLLPLLALLAVGAPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREVED
TQVGEVELGTGLQPFPAEAPKQKRGIVEQCCTGVCSLYQLENYCN
NT seq 318 nt   +upstreamnt  +downstreamnt
atggccctgtggacgcgcctcctgccgctgctggccctgttggccgtcggggcacccccg
cctgccagggccttcgtcaaccagcacctgtgtggctcccacctggtggaggcgctgtac
ctggtgtgtggggagcgaggcttcttctataccccaaagacccgccgggaggtggaggac
acacaagtgggggaggtggagctgggcacgggcctgcagccctttccggcggaggcgccc
aagcagaaacgtggcatcgtggagcagtgctgtacgggcgtctgctccctgtaccagctg
gagaactactgcaactag

DBGET integrated database retrieval system