KEGG   Loxodonta africana (African savanna elephant): 100661148Help
Entry
100661148         CDS       T04351                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00030  Pentose phosphate pathway
lav00051  Fructose and mannose metabolism
lav00052  Galactose metabolism
lav01100  Metabolic pathways
lav01200  Carbon metabolism
lav01230  Biosynthesis of amino acids
lav03018  RNA degradation
lav04152  AMPK signaling pathway
lav05230  Central carbon metabolism in cancer
Module
lav_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100661148 (PFKP)
   00030 Pentose phosphate pathway
    100661148 (PFKP)
   00051 Fructose and mannose metabolism
    100661148 (PFKP)
   00052 Galactose metabolism
    100661148 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100661148 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100661148 (PFKP)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100661148 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100661148 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100661148 (PFKP)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100661148 (PFKP)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100661148 (PFKP)
Messenger RNA biogenesis [BR:lav03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100661148 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100661148
NCBI-ProteinID: XP_023404499
LinkDB All DBs
Position
Unknown
AA seq 778 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGPNIVEASWESVSSILQVGGTIIGSARC
QAFRTREGRLKAAYNLIQLGITNLCVIGGDGSLTGANIFRKEWSGLLEELAQSGKIDSDA
MKKHAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPESPPEEGWEENMCVKLSENRARKKRLNIIIVAEGAIDS
QNKPITSEKIKDLVVKQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATP
EIPACVVSLSGNHAVRLPLMECVQMTQDVQKAMDERRFKDAVQLRGMSFESNLNTYKRLC
IKRPDSHIVKSNYNVGIINVGAPAAGMNAAVRAAVRVGISDGHRMLAIYDGFDGFFKGQV
SLMEGTRLRNIPNLSIICGFYQVNTTYIIITVKLVCQPLTSRLDLTIFSTLPGKYLEEIA
EQMRAHNINALLIIGGFEAYLGLLELSAARETHEEFRVPMIMVPATVSNNVPGSDFSIGA
DTALNTITDTCDRLKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEEPFDI
RDLQSNVEHLTEKMKTTIQRGLVLRNENCNENYTTDFICQLYSEEGKGVFDCRKNVLGHM
QQGGAPSPFDRNFGTKLSSRAVQWITTKLKESQGTGKKFVTDDSVCVLGISKRNLVFQPV
ADLRKDTDFEHRIPKEQWWLKLRPVMKILAKYKASYDVSDSGQLEHVHLRPHEESAGI
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgttcgggctgtcgtgcgtatgggaatctacgtgggagccaaagtgtat
tttatatatgagggttaccagggtatggtagacggaggtcctaatattgttgaagcctca
tgggaaagtgtctcaagcattctacaagtgggagggacaatcattggcagtgcacgttgc
caggcgtttcgtactcgggaaggtcgcctaaaagccgcctataacttgatacagctggga
attaccaatctgtgtgtgattggtggggatggaagcttaacgggtgccaatatcttccgg
aaggaatggagtggactgctggaagagttggcccaaagtggcaagatcgattcggatgcc
atgaagaagcacgcatacctcaacatcgtgggcatggtgggctccatcgacaacgacttc
tgtgggactgacatgactatcggcacggactcagctctgcacaggatcattgaagttgtt
gatgccatcatgaccacggcgcagagccaccagaggacctttgttctggaggtcatgggg
agacactgtggatatctagccctggttagtgccttggcctgcggtgcagattgggtgttc
attcctgaatctcccccagaagaaggctgggaagaaaatatgtgcgttaaactgtcagag
aaccgtgctcgaaagaaaaggctgaatattatcattgtggctgaaggagctattgattcc
caaaataaacctattacttctgagaaaatcaaggatttagtagttaagcagctgggatat
gacactcgagtgacaattcttgggcatgtgcaaagaggaggaaccccatcagcctttgac
aggattttggccagtcgcatgggggtggaggccgtcatcgcccttcttgaagcgacccca
gagatcccagcctgtgtggtatcgctgagcggaaaccacgctgtgcgcctgcccctgatg
gagtgtgtgcagatgacccaggatgtgcaaaaggcaatggatgaaagaagatttaaagat
gctgtacaacttcgaggaatgagctttgagagcaacctgaacacttataagcggctttgc
atcaagcgtccagactcacacatcgtgaagagcaattataacgtgggtattataaacgtg
ggtgcccctgcggctggcatgaacgccgctgtgcgcgctgctgtacgtgtggggatatct
gacggccacaggatgctcgccatctacgatggctttgatggatttttcaaaggtcaggtg
agtctcatggaaggcacaaggctgaggaatatccctaacctgagtatcatatgtggattc
tatcaggttaacacgacgtatatcatcataactgtgaagcttgtctgtcagcctctgacc
tcacgtcttgatttaaccatttttagtactctacctgggaagtatttggaagagattgct
gaacagatgcgtgctcataatatcaacgctctattgattattggtggatttgaggcttac
ctgggactgctagagctgtcagctgcccgggagacacacgaggagttccgtgttcccatg
attatggttcctgctactgtctccaacaacgtccccggttcagatttcagcatcggcgcc
gacactgctctgaacaccatcactgacacatgcgaccgcctcaaacagtcagccagtggg
accaagcgccgtgtgttcatcattgagaccatgggcggctactgcggttacctggccaac
atggggggccttgcggccggagcggacgcagcttatatttttgaagagccgtttgatatc
agagacctacagtccaacgtggaacacttgacagagaaaatgaagaccaccattcagagg
ggtcttgtgctcagaaacgagaactgcaatgaaaattataccactgacttcatttgccag
ctttattcagaagaaggaaaaggagtgttcgattgcagaaagaatgtgctgggccacatg
cagcagggtggagcaccttctccatttgacagaaactttggaacaaaactgtcttccaga
gctgtgcagtggattacgacaaaactgaaggaatcccagggaacaggaaaaaagtttgta
actgatgactcagtctgtgtgctgggaataagcaagagaaaccttgtttttcaaccagtg
gcagacctaaggaaggacacagatttcgagcacagaattcccaaagaacagtggtggttg
aaactgcggcctgtaatgaaaattttggctaagtacaaagcaagctatgacgtttctgat
tcgggccagctggaacatgtgcatctccgtcctcatgaggaatctgcagggatttaa

DBGET integrated database retrieval system