KEGG   Loxodonta africana (African savanna elephant): 100661273
Entry
100661273         CDS       T04351                                 

Gene name
BTC
Definition
(RefSeq) probetacellulin
  KO
K09783  betacellulin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100661273 (BTC)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100661273 (BTC)
SSDB
Motif
Pfam: EGF Cadherin_C_2 Sigma_reg_N Baculo_11_kDa Vpu LapA_dom TMEM154 EphA2_TM DUF2663
Other DBs
NCBI-GeneID: 100661273
NCBI-ProteinID: XP_003414264
LinkDB
Position
Unknown
AA seq 193 aa
MGMKMLYLISLPERSDKRQSDYEEPKSQIKDVWTRARLVILHCVVADVNSTRSPETENLL
CEDPGKNCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCEEGYTGARCE
RVDLFYLRGDRGQILVICLIAVMVIFIILVIGVCTCCHPLRKSRKRRKKEEEMETLGKDI
TPIDEDIQETNIA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggaatgaaaatgctttatttgatcagcctgccagagagaagtgacaagaggcagtca
gattatgaagaaccaaaaagccagatcaaagatgtttggacccgagcccgtctagtgatc
ctccactgtgttgtagcagatgtgaactcaaccagaagtcctgaaactgaaaaccttctc
tgtgaagatcctggaaaaaactgtgcagctaccaccacgcagtcaaagcggaaaggtcac
ttctctcgatgtcccaagcaatacaagcattactgcatcaaagggagatgcaggttcgtg
gtggccgagcagacaccctcctgtgtctgcgaggaaggctacacgggagcaaggtgtgag
agagttgacttattttacctacggggagacagaggacagattttggtcatttgtttgata
gcagttatggtaatttttatcatcctggtgatcggtgtctgcacgtgctgtcatcctcta
aggaaaagtcgtaaaagaaggaagaaggaagaagaaatggaaactctgggtaaagatata
actcctatcgatgaagatattcaagagactaatattgcttaa

DBGET integrated database retrieval system