KEGG   Loxodonta africana (African savanna elephant): 100661281
Entry
100661281         CDS       T04351                                 

Gene name
ATR
Definition
(RefSeq) serine/threonine-protein kinase ATR isoform X1
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03460  Fanconi anemia pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100661281 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100661281 (ATR)
   04115 p53 signaling pathway
    100661281 (ATR)
   04218 Cellular senescence
    100661281 (ATR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100661281 (ATR)
   05170 Human immunodeficiency virus 1 infection
    100661281 (ATR)
   05165 Human papillomavirus infection
    100661281 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100661281 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lav03400]
    100661281 (ATR)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100661281 (ATR)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100661281 (ATR)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100661281 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I THP2
Other DBs
NCBI-GeneID: 100661281
NCBI-ProteinID: XP_003416220
UniProt: G3TF68
LinkDB
Position
Unknown
AA seq 2643 aa
MGEHGLELASMIPALRELGSASPEDYNIVVQKPRQILCQFVDRILTDVNVVAVELIKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHGQNEAKGSCIEFSNWIITRLLRIAASPSCQ
MLHKKICEVICSLLFLFKSKSPAILGALTKELLHLFEDLIYLHRRNAMGHSVEWPVVASR
FLSQVDEHMGYLQPAPLQFMSWQNLEFIEVTLLTVLIRIIAIVFFRRQELLLWQIGCALL
EYGSPKVKSLAIRLSTELFELGGLPEQPASTFFTSFFELLKRLVEMDADQLKLYEEPLSK
LVKTLFPLEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFV
PAGYESALPVRKVYVGNICRALVDVLGVEGEAEYLLGPLYEALKMESMEIIEEVQCQTQQ
EKLSGNSDGISPKRHQLSLSLSSSKRALKQTEEIKHVDMSKKSILWSALRHKAESLQVIL
ECNSPDNPVIETLEGITVVLQLTALCTVHCSHQNTDCHDFKDSQHKYKKKLSIVVTWMSL
DFYTKVLKACRNLLESIKKPDLETVIDKVVKIYDALIYMQVKSSFEDEILKDLCGMLSLP
WIYPHSDDGALKLTTFATNLLTLSQRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYN
WALQSSHEVIRASCVSGFFILLQQQSSCNRAPKILIDKVKDDSDIVKKEFASILGQLVCT
LHGMFCLTSSLTEPFSEHGHVDLFCKNLKVTSQHECSSSRLKASVCKPFLFLLKKKTSSP
VKLAFIDNLHHLCKHLDFREDETDVKIVLGTLLNLMEDPDKDVRVAFSGNIKHILGSLDS
EDGFIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLL
SKSASVSGAAYTEIRALVAAKSVKLQNFFSQYKKPICQFLVESLHSSQMTALPSTPCQNA
EMRKQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTL
GKQLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHN
ELLLRIGEHYQQVFNGLSILASFASSDDPYQGPRDITSPELMADYLQPKLLGILAFFNMQ
LLSSSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWD
CFVRCLDHAYLGSLLSHVIVALLPLIHVQPKETAAIFHYLIIENRDAVQDFLHEIYFLPD
HPELETIKAVLQEYRKETSESTNLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEK
LIKYATDSETVEPVISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQ
GKDFTFVTGVEDLGFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMQRDG
PGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGNNFADWSASWAGY
LITKVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLK
HDDQHSINAQDSASDLCQLSTQTVFSMLDHLTQWSRHKFQTLKAEKFPQSKSHRDKVDAM
ASTVDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFIIEKKQNIQEHLGFLQ
KLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQIIHYH
GVVKSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKS
TTWSVRLGQLLLSAKKRDTTAFYDTLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHML
CELEHSIRPLFHQSPGDSAQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYS
EMVGECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALMVIQ
KGVELCFPENQSPAESKNMLIHGRAILLVGRFMEETANFESNAIMKKYKDVTLVLPEWED
GHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLSLWLDY
GAKAYEWEKAGRSDRVQMRNDLAKINRVITEHTNHLAPYQFLTAFSQLISRICHSHDEVF
VVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATR
LTDKLLELCNRPVDGSSSTLSMSIHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTH
ANHEPFPGHWAYIAGFDDMVEVLASLQKPKKICLKGSDGKSYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALTEKLKVFQEFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTLRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGNSKAHNETG
EVVNEKAKTHVLDIEQRLQGVIKTHNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWT
PYM
NT seq 7932 nt   +upstreamnt  +downstreamnt
atgggcgaacatggcctggagctggcgtctatgatcccggctctgcgggagctgggcagt
gccagtccagaggattataacatagttgtacagaagccaagacaaatcctatgtcagttc
gttgaccgcatccttacagatgtgaatgttgttgctgtggaactcataaagaaaacggac
tctcagccaacctctgtgatgttgctggatttcattcagcacatcatgaagtcgtcccca
cttatgtttgtaaatgtgagtggaagccatggccaaaacgaggccaaaggcagttgcatt
gaattcagtaattggattataacaagacttctgaggattgcagcaagtccatcctgtcaa
atgttacacaagaaaatctgtgaagtcatctgttcattattatttctttttaaaagcaag
agtcctgctattttgggggcactgacaaaggaattattacatcttttcgaagacttgatt
tacctccacagaagaaatgcaatgggacactccgtggaatggccagtggtagctagccga
tttttaagtcaagtagatgaacacatgggatatttacaaccagctcctttgcagtttatg
agttggcaaaatttagaatttattgaagtcactttattaacggttcttattcgtattatt
gcaattgtgttttttagaaggcaagaactcttactttggcagataggttgtgctctgctg
gagtatggtagtccaaaagtgaaatccttagcaattcgcctctcaaccgaactctttgaa
cttggagggctcccagaacaaccagccagcacttttttcacctcattttttgaattatta
aaacgccttgtagaaatggatgccgatcaactaaaactttatgaagagccattgtcaaag
ttggtgaagacattattccccttagaagcagaagcttatagaaacattgaacctgtctat
ttaaatatgctgctggaaaaactctgtgtcatgtttgaagatggtgtgcttatgcggctt
aagtctgatttgctaaaagcagctttgtgccatttactgcagtactttcttaaatttgtg
ccagctggatatgaatccgctttaccagtcaggaaggtctatgtcggaaatatttgtagg
gctcttgtggatgtgcttggagttgagggagaagcagagtacttgttgggtccactttat
gaagccttaaaaatggaaagtatggaaatcattgaggaggttcagtgccaaactcaacaa
gaaaaactcagcggcaacagtgatggaatatcacccaaaagacatcaactcagcttgtct
ttaagttcttccaaaagagcactgaagcagactgaggaaattaaacatgtggatatgagc
aaaaagagcatattatggagtgcactgagacacaaagctgaatccctgcaggttattctt
gaatgcaatagtccggacaatcctgttattgagactttagagggaatcactgttgtcctg
caactcactgcactgtgtacggttcactgttctcatcaaaacacggactgccatgatttc
aaggattctcaacacaaatataagaagaaactttccatagtggtaacttggatgtctttg
gatttttatacaaaagtgcttaaggcttgtaggaatttgttagaatctattaaaaaacct
gacttggagacagtcattgataaagtggtgaaaatatatgatgctttgatttatatgcaa
gtaaaaagttcatttgaagatgaaattctgaaagatttatgtggaatgctctcacttcca
tggatttatccccattctgatgatggtgctttaaaattgaccacatttgccactaatctt
ctaacattaagccagagaatttcagatagctactcaccacaggcacagtcacgatgtgtg
tttcttctgactctgtttccaagaagaatattccttgaatggagaacagcagtttataac
tgggcactgcagagctcccatgaagtaatccgggctagttgtgttagtggattttttatc
ttactgcagcagcagagctcttgtaacagagctcctaagattcttatagataaagtcaaa
gatgattctgacattgtcaagaaagaatttgcctctatacttggccaacttgtctgtact
cttcatggcatgttctgtttgacaagttctttaacagaacctttctctgaacatggacat
gttgacctcttctgtaagaacctgaaagtcacttctcaacacgaatgttcatcatctcga
ctaaaagcttctgtttgcaagccatttcttttcctactgaaaaaaaaaacatctagtcca
gtaaaacttgctttcatagataatctacatcatctttgcaagcatcttgattttagggaa
gatgaaacagatgtaaaaatagttcttggaactttattaaatttaatggaagacccagac
aaggatgttagagtggcttttagtggaaatatcaagcatatattgggatctttggactct
gaagatggatttataaaagagctttttgtcttaagaatgaaagaagcctatacacatgcc
caaatatccagaaataacgagttaaaggataccttgattcttacgacaggggatatcgga
agggcagcaaaaggagatttggtaccttttgcactgttgcacttattgcattgtttgtta
tccaagtcagcatctgtctctggggcagcttacacagaaattagagctctggttgcagct
aaaagtgttaaactgcagaactttttcagccagtataaaaaacccatctgtcagtttttg
gtagaatccctccactccagtcagatgacagcacttcctagtactccatgccagaatgct
gagatgagaaagcaagacgtagctcaccagagagagatggctttaaataccttgtctgaa
attgccaatgtttttgattttcctgatcttaatcgtttccttactaggacgttacaagtt
ctgctacctgaccttgctgcaaaagcaagccctgcagcttctgctctcattcgaacttta
ggaaaacaactaaatgtcaatcgtagagagattttaataaataacttcaaatatattttt
tctcatttggtctgttcctgttccaaggatgaattagaacgtgcccttcattatctgaag
aatgaaacagaaattgaactgggaagcctgttgagacaggatttccaaggactgcataat
gaattactgctacgtattggagaacactatcagcaggttttcaatggtttgtcaatactt
gcctcatttgcatcaagtgatgatccatatcagggcccaagagatatcacatcgcctgaa
ctaatggctgattatttgcagcccaagttgttgggcattttggcattttttaacatgcag
ctactgagctccagtgttggcattgaggataagaaaatggctttgaacagtttgatgtcg
ttgatgaagttgatggggcccaaacatgtcagctccgtgagggtgaagatgatgaccact
ctgagaactggccttcgattcaaggacgattttcctgagctgtgctgcagagcttgggac
tgctttgttcgttgcctggatcatgcttatctaggctcccttctcagtcatgtcatcgta
gctttgttacctctcatacacgtccagcctaaagaaactgcagctatattccactacctc
atcatcgaaaacagggatgctgtgcaagactttcttcatgaaatatattttttacctgat
catccagaactagaaacaataaaggcagttctccaggaatacagaaaggagacttctgag
agcaccaaccttcaaacaactcttcagctgtccatgaaagcaattcagcatgaaaatgtg
gatgttcgcattcatgctcttaccagcttgaaggaaaccttgtataaaaatcaggaaaaa
ctgataaaatatgcaactgatagtgaaacagtagaacctgttatctcacagttggtgaca
gtgcttttgaaaggttgccaagatgccaactctcaagctcgactgctctgtggagaatgt
ttaggggagttgggggcaatagatccaggtcgactagacttctcaacaactgaaacccaa
ggaaaagattttacatttgtgactggagtagaagatttaggctttgcctatggattattg
atggagctaacaagagcttacctggcgtatgcagataacagtcgggctcaagattcagct
gcttatgccattcaggagttactttctatttatgactgtagagagatgcagcgtgacggc
ccaggtcaccagttatggaggaggtttcctgagcacgttcgggaaatactggagcctcat
ctaaataccaggtataagagttctcagaagtcaacagattggtctggagtaaagaagcca
atttacttaagtaaattaggcaataactttgcagattggtcagcatcttgggcaggttat
cttataacaaaggtacgacatgatctcgccagtaaaatctttacctgctgtagcattatg
atgaagcatgacttcaaggtgaccatctatcttcttccacatattcttgtctatgttttg
ttgggctgtaatcaagaagatcagcaggaggtttatgcagaaattatggcagttctgaag
catgatgatcagcatagcataaatgcccaagatagtgcatctgatctgtgtcagctcagt
acacagacagtgttctccatgcttgaccatctcacacagtggtcaaggcacaaatttcag
acactgaaagctgagaagtttccacagagcaaatcacacagagacaaggtggatgcaatg
gcatctactgtggattatgaagactatcagagtgtaactcgttttctagacctcatacct
caagatactctggcagtagcttccttccgctccaaagcatacacacgagctgtaatgcat
tttgaatcatttattatagaaaagaagcaaaatattcaggagcatcttggatttttacag
aaattgtatgctgccatgcatgaaccagatggagtggctggagtaagcgcaattcgaaag
gcagaaccatctctaaaagaacagatccttgaacatgaaagcattggcttactgagggat
gccactgcttgctatgacagagctattcagctagaaccagaccagattattcattatcat
ggtgtagtgaagtccatgttagggcttggtcagctgtctactgtaatcactcaggtgaat
ggcgtgcatgctaacaggtctgaatggacagatgaattaaacacatacagagtggaggca
gcttggaaactgtcacagtgggatttggtggaaaactatttggcagcagatgggaaatct
acaacatggagtgtcagacttggacagctattattatcagccaaaaaaagagataccaca
gctttttatgacactttgaaactagtgagagcagagcaaattgtacctctttcagctgca
agctttgaaagaggctcctaccaacgaggatatgaatatattgtgagactgcacatgttg
tgtgagctggaacatagcatcagaccactttttcaccagtctccaggtgacagtgctcaa
gaagattctctaaactgggtagctcgactagaaatgacccagaattcctacagagctaag
gaacccatcctggccctccggagggctttgttaagcctcaacaaaagaccagattacagt
gaaatggttggagaatgctggctgcagagcgccagagtagccagaaaggctggtcaccat
cagacagcctacaacgctctccttaatgcgggagagtcacggctcgctgaactgtatgtg
gagagggcaaagtggctgtggtccaagggtgatgttcaccaggcactgatggttattcaa
aagggcgtcgaattgtgttttcctgagaatcaaagccccgctgagagcaagaacatgtta
attcatggtagagccatattactagtgggtcgatttatggaagaaacggctaactttgaa
agcaatgcaattatgaaaaaatataaggatgtgaccttggtcctaccagagtgggaggat
ggacatttctaccttgcaaagtactatgacaaattgatgcccatggtcacagacaacaaa
atggaaaagcaaggtgatctcatccggtacatagtccttcattttggaagatctctacag
tatggaaatcaattcatatatcagtcaatgccacgaatgttatcactgtggcttgattat
ggtgctaaggcatatgagtgggaaaaagctggccgctctgatcgtgtacaaatgagaaat
gacctggctaagataaacagggtgatcacagagcacacaaatcatttagctccgtaccag
tttttgactgctttttcacagttaatctcccgaatttgtcattctcatgatgaagttttt
gtggtcttgatggaaattatagccaaagtgtttctggcctatcctcaacaagcgatgtgg
atgatgacagctgtatcaaagtcttcttatcctatgcgtgtgaacagatgcaaggaaatc
ctaaataaagcaattcatatgaaaaagtccttagaaaagtttgttggagatgcaactcgc
ctaacagataagcttctagaattgtgcaatagaccggttgatggaagtagttctacatta
agcatgagcattcattttaaaatgcttaaaaagctggtagaagaagcaacgtttagtgaa
atcctcattcctttgcagtcagtcatgatacctactcttccatcaattctgggcacccat
gcaaatcatgaaccatttcctgggcattgggcctatattgcaggctttgatgatatggtg
gaagttctggcttctcttcaaaagccaaagaaaatctgtttaaaaggatcagatggaaag
tcctacatcatgatgtgtaagccaaaagatgacctgagaaaggattgtagactaatggag
ttcaattccctgattaataagtgcttaagaaaagatgcagaatctcgtagaagagaactc
catatccgaacatatgcagttattccactgaatgatgaatgtgggattattgaatgggtc
aacaacactgctggcttgagacctattctgaccaaactatataaggaaaagggagtgtac
atgacaggaaaggaactgcgccagtgtatgctaccaaagtcggcagcattaacggaaaaa
ctcaaagtattccaagaatttcttctgcccaggcatcctcctatttttcacgagtggttt
ctgagaaccttccctgatccaacctcatggtacagcagcagatcagcatattgtcgttcc
acggcggtcatgtcaatggttggttatatcctggggcttggagatcgtcatggtgaaaac
attctctttgattctttgactggtgaatgcgtacatgtggatttcaactgtctcttcaat
aagggagaaacctttgaagttccagaaattgtgccttttcgcctgactcataatatggtt
aatggaatgggtcctatgggaacagaaggtctttttcgaagagcttgtgaagttacgctg
cggctgatgcgagatcagagagagcctttaatgagtgtcttaaagacttttctacatgat
cctcttgtggagtggagtaaaccagtgaaagggaattccaaagcacataatgaaaccggg
gaagttgtcaatgaaaaggccaagacccatgttcttgacattgagcagcgattacaaggt
gtaatcaagactcataacagagtgacagggctgccattatctattgaaggacatgtgcat
taccttatacaagaagctactgacgaaaacttactatgccaaatgtatcttggctggacc
ccttatatgtga

DBGET integrated database retrieval system