KEGG   Loxodonta africana (African savanna elephant): 100661293Help
Entry
100661293         CDS       T04351                                 

Gene name
MGAM
Definition
(RefSeq) LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00052  Galactose metabolism
lav00500  Starch and sucrose metabolism
lav01100  Metabolic pathways
lav04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100661293 (MGAM)
   00500 Starch and sucrose metabolism
    100661293 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100661293 (MGAM)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100661293 (MGAM)
    3.2.1.20  alpha-glucosidase
     100661293 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100661293
NCBI-ProteinID: XP_023394914
LinkDB All DBs
Position
Unknown
AA seq 1815 aa AA seqDB search
MARKKFTSLEFMLSVLLLVVFIITIPIFVLSARHSLESEDPGTSASPISAECPVVNEQER
INCIPDQPPTKATCDQRGCCWNPQGTISVPWCYYSKSHGYQTEGDPVNTTAGFTVQLRRL
PSPSLFGSDVDNVLLTAEYQTSNRFHFKLTDQDKDRYEVPHEHVQPFEGNAPSSLSYKVE
VSKQPFSIKVTRQSNNRVLFDSSIGPLLFADQFLQLSILLPSANVYGLGEHVHQQYRHDM
NWKTWPIFARDAFPNEDVKNLYGTQTFFLCLEDASGLSFGVFLMNSNAMDVVVQPAPAVT
YRVIGGILDFYVFLGNTPEQVVQEYLELIGRPVLPTYWALGFHLSRYDYESLDNMKEVVE
RNRAAGLPYDVQHADIDYMDQRKDFTYDSVNYKGFPEFVKELHNNGQKLVIIVDPAISNN
SSTSSPYGPYDRGSDLKIWVNASDGVTPVVGEVWPGKTVFPDYTNPKCADWWANEFQLFH
NQVEFDGIWIDMNEVSNFVDGSVSGCSTSHLNYPPFTPSVLDGYLFRKSLCMDAVQHWGK
QYDVHNLYGYSMAISTAEAVKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRW
SIPGVLEFNLFGIPMVGADICGFLMDVSEELCRRWMQLGAFYPFSRNHNCQGYKAQDPAS
FGADSLLLNSSRHYLNIRYTLLPYLYTLFYHAHTRGDTVARPLLHEFYSDSSTWDVHRQF
LWGPGLLITPVLDEGAEKVLAYVPDAVWYEYETGARIRWRKQQVEMELPGDKIGLHLRGG
YIFPTQEPSTTTEASRRNPLGLIIALDENKEAKGELFWDDGEAKDTVANNMYVFCEFSAT
QNQLDVKILQSAYKDPNNLSFKEIKILGTQEPGNVIVKHNGVPSQISPKVTYDANLQVAV
ITELDLVLGEAYTVEWDLKISDTEKIDCYPDQQGASAENCLARGCVWEESSISGVPFCYF
VSDLYSVDVVQYKADGATADISLKTGVYADAFPSTPVTSLRLDVTYHKDDMLQFKIYDPN
NSRYEVPVPLNIPRTPSSTSEGQLYDVRIKKNPFGIEIRRKSTGTIIWDSQVLGFTFNDM
FIRISTRLPSRYLYGFGETEHTAFRRDLNWHTWGMFSRDQPPGYKLNSYGVHPYYMALEE
DGSAHGVLLFNSNAMDVTFQPMPALTYCTTGGILDFYVVLGPTPELVTQQYTELIEESVM
VLYWVLGFQLCRYGYLNDSKIVSLYDEMMDPQTPTTAATHVLVSSXDVQYSDIDYMERQL
DFTLSPKFTGFPALITRMKNDGMRVVLILDPAISGNETQPYLAFTRGVENDVFIKDPDGG
IVWGKVWPDLPGIVINNSLDWDSQVEVKAFGVSGAVKIARKGHPYLGHRCDMNEPSNFVN
GAVPSGCKNPTLNHPPYMPALESRDVGLSSKTLCMEGQQVLADGSLVRHYDVHNLYGWAQ
TRPTYEAVQEVTGERGIVISRSTFPSSGRWAGHWLGDNTSAWNQLKKSIIGMMEFSLFGI
SYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNGLGYRRQDPVSWDAAFENISRSVL
HTRYTLLPYFYTLMYKAHVEGSTVVRPLLHEFVSDQVTWDVDDQFLLGPAFLVSPVLEPN
ARNVAAYFPRARWYDYYTVGGIHYLLTPRTQSLCHKELPFALLCFCQKQWFVPVTLLCLT
SLPLRCSRQNFVGFKVALDDQGAAEGCLFWDDGYSIDTYENGNYYLANFSASQNTMKSHI
ILNNYIFSTNPLKLGYFEIWGVGSIPITSVSISLSNMVMTPTFKYNSTTQVLTVDVTSNN
INLPDFISLTWASTL
NT seq 5448 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagtttacttctttggagtttatgctcagtgttcttctgctggtggta
tttattatcaccatccctatatttgtgctttcagccagacattctttggaatcagaagat
cctgggacaagtgcatcccctatctctgcggagtgccctgtggtaaatgaacaggagcgg
atcaactgtatccctgaccagccaccaacaaaggccacgtgtgaccagcgaggctgctgc
tggaaccctcagggaaccatcagtgtgccctggtgctactattccaagagtcacggctat
cagacagaaggagaccctgtgaacacaacggcaggattcacagtccagctgaggaggctg
ccttctccatccctgtttggaagcgatgttgacaatgtcctcctcacagcagaataccag
acatccaaccgattccacttcaagttaactgaccaggacaaagacaggtacgaagtacca
catgaacacgtgcagccttttgaaggaaatgctccttcttcattgtcttacaaagtggaa
gtctccaaacagccgttcagcatcaaagtgacccgccaaagcaacaaccgtgttctgttt
gactcaagcattgggcccctcctctttgccgaccagttcttgcagttatccatcctcctg
cccagtgccaacgtgtacgggctgggggagcacgtgcaccagcagtaccgccacgacatg
aactggaagacctggcccatctttgccagggacgcattccccaacgaggatgtaaagaac
ctgtacggcacgcagacgttcttcctatgccttgaagatgctagtggcttgtcgtttggg
gtgtttctgatgaacagcaatgccatggatgttgtcgtccagcctgccccagcagtcacg
taccgtgtcattgggggcattctcgacttctatgtgttcttgggaaatactccagaacaa
gttgttcaagagtatctagagctcattggacggccagtcctgcccacatactgggctctt
gggtttcatctcagccgttatgattatgaaagtctcgacaatatgaaagaagtggtggag
agaaaccgagcagctgggctcccttatgatgttcagcatgccgatattgattacatggac
cagaggaaggacttcacttatgactcagtcaattataaaggcttccctgagtttgttaag
gagttacacaataatggacagaagttggtcatcattgtggatccagccatctctaacaac
tcttccacaagtagcccatatggcccctatgacaggggctcagatctaaagatatgggtg
aatgcttcagatggagtgactccagtcgtcggggaggtctggccaggaaaaactgtgttt
cctgattacaccaatcccaaatgtgctgattggtgggcaaatgaatttcagcttttccac
aatcaagtagagtttgatggaatatggattgatatgaacgaagtctccaactttgttgat
ggttcagtttcaggatgttccacaagccatctgaattatcccccattcactcccagtgtc
ctggacgggtacctgttccgcaaaagcctctgcatggatgccgtgcagcactggggcaag
cagtacgatgtccacaacctgtatggctactccatggcgatctccactgctgaagctgtc
aagactgtattccccaataagaggagcttcattctaacccgctctacctttgcggggtct
ggcaagtttgcagctcattggctaggggacaacacggccacctgggacgacctccgatgg
tccatccccggcgtacttgagttcaacctttttggtattccaatggtgggtgctgacatc
tgtggcttcttgatggatgtctctgaggagctctgcagaaggtggatgcagctgggagcg
ttctacccattttcccggaatcacaattgccaaggctacaaggctcaggaccctgcctcc
tttggagctgactccctgctgctcaactcctccaggcactacctgaacatcagatacacc
ttgctgccctacctgtacacccttttctaccatgcgcacacccgcggggacacagtagcc
cggcccctgctgcacgagttctacagcgacagcagcacttgggatgtgcaccggcagttt
ctgtgggggccaggcctcctcatcactccagttttggatgagggtgcagagaaagtgctg
gcctacgtgcccgatgccgtctggtacgaatacgagactggggcccgaatacggtggcgt
aagcaacaagttgagatggaacttcctggagacaaaatcggactccacctcagaggaggc
tacatcttccccacccaggaacccagcaccaccactgaggccagtcgacggaaccctctt
ggcctcattattgccctagatgagaacaaagaagccaaaggggagctgttctgggacgat
ggggaagccaaagatactgtggccaataacatgtatgtcttctgtgaattttccgccacg
cagaaccaattggatgtgaagattttgcaatcagcctacaaagaccccaataacttatca
tttaaggagattaaaatccttgggacccaggaacctggaaatgttatagtgaagcacaat
ggtgtcccaagtcagatttctcctaaagtcacttacgatgctaacctccaggttgctgtt
atcacagagcttgaccttgtcctgggggaggcttacacggtggagtgggatctgaagata
agtgacacagagaaaattgactgctaccctgaccagcaaggtgcttctgcggagaactgc
ttggctcgtggctgtgtctgggaggaatccagtatttcgggagtccctttttgctatttt
gtcagtgatctgtactctgtcgatgttgttcagtacaaggcagatggggccactgccgac
atctccttaaagactggtgtttatgccgatgcctttccttcaacccccgtgacctccctc
cgcctggacgtcacctaccataaggatgacatgctgcagtttaagatttatgatcccaac
aatagtcggtatgaagtcccagtgcctctcaacatacctaggacaccatccagcacctct
gagggtcagctatatgatgtccgcattaagaagaatccgtttgggattgaaattcgcagg
aagagcacaggcaccatcatctgggactctcaggtccttggcttcaccttcaacgacatg
tttatccgcatctccacccgcctcccctcccgctacctctatggctttggggaaactgag
cacacggccttccgcagagacctgaactggcacacgtggggcatgttctcccgggaccag
cccccagggtacaagttgaactcctatggtgtgcatccctactacatggcgctggaggag
gatggcagtgcccacggagtgctcctgttcaacagcaatgccatggatgtgacattccag
cccatgcctgccctgacgtactgtaccacaggaggaattctggacttttatgtggttttg
gggccaaccccagagcttgtcactcagcagtacactgagttgatcgaagagtctgtcatg
gtgctctattgggtcttggggtttcagctgtgtcgctatggatacctaaatgactcaaaa
attgtcagcttgtatgatgaaatgatggacccccagactcctactacagcagccacccat
gtccttgtgtcctcgtaggatgtgcagtactccgacatcgactacatggagcggcagctg
gacttcaccctcagccccaagtttactgggtttcctgctctgatcacacgcatgaaaaat
gatgggatgcgggtcgttctcattctggacccagccatttctggtaatgagacccaaccc
tatctcgcgttcacccggggcgtggagaacgatgtcttcatcaaggacccagatggtggc
attgtctggggaaaggtctggcccgatcttcctggtattgtcattaacaactctctagac
tgggacagccaagtggaggtaaaggcctttggggtatcaggtgcagtcaagattgccagg
aaggggcatccatacctaggacatagatgtgacatgaatgagccatcgaactttgtgaat
ggggctgtcccttcaggctgcaaaaaccccaccctcaaccacccaccctacatgccagct
ctggagtccagggacgtaggcctgagcagcaagacgctgtgcatggagggccagcaggtg
ctggcggacggctccctggtgcggcactatgatgtgcacaacctgtacggctgggcccag
accaggcccacctacgaagctgtgcaggaggtgacaggggagcgaggcatcgtcatctcc
cgctccaccttcccttcctctggccgctgggcaggacactggctgggagacaacacgtca
gcctggaaccagttgaagaaatccattatcggcatgatggagttcagcctttttggcata
tcctatacgggagctgatatctgtgggttctttcaagatgcagaatatgagatgtgtgtc
cgctggatgcagctgggggccttctaccccttctccaggaaccacaacggccttgggtac
aggagacaagaccctgtgtcctgggatgccgcctttgagaacatctccaggagcgtcctg
cataccagatacactctgctgccgtacttctacaccctgatgtacaaggcccacgtcgag
ggcagcaccgttgtgcgaccccttctccatgagtttgtgtcagaccaggtgacctgggat
gtagatgatcagttcctgctgggccctgccttcctggtcagccctgtcttggagcctaat
gccagaaatgtcgctgcttatttccctagagcccgctggtatgattactacacggttggt
ggaattcactatctcttgactcccaggacccagtctctatgccacaaggaacttcctttt
gctcttttatgtttttgccaaaaacagtggtttgtgccagtgaccttgctttgtctcaca
tctctcccacttcgctgcagccgccagaatttcgtgggcttcaaggttgccttggatgac
cagggtgctgctgagggctgcctcttctgggacgatgggtacagcattgatacctatgaa
aatggaaactattacttggcaaacttttctgccagccagaatacgatgaagagtcatata
attttaaacaactacatcttcagtacaaaccctttgaaactgggatattttgagatctgg
ggagtgggcagtatccccatcaccagtgtcagcatctctctaagtaacatggttatgaca
ccgaccttcaaatacaactctacaacacaggtgctaacggttgatgtaaccagcaacaat
atcaacctgcctgacttcatttcattgacatgggcaagcactctgtga

DBGET integrated database retrieval system