KEGG   Loxodonta africana (African savanna elephant): 100661356
Entry
100661356         CDS       T04351                                 

Gene name
CDKN2D
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100661356 (CDKN2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100661356 (CDKN2D)
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 100661356
NCBI-ProteinID: XP_003413138
UniProt: G3U8W3
LinkDB
Position
Unknown
AA seq 166 aa
MLLEEVHAGDRLSGAAARGDVQEVRRLLHRELMHPDALNRFGKTALQVMMFGSPTIALEL
LKQGASPNVQDVSGTTPAHDAARTGFLDTLKVLVEHGADVNTPDGTGALPIHLAVREGHA
AVVSFLAAESDLHHRDARGLTPLELAQQRGARDLMDILQGHLVAPL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgctgctggaggaggtccatgccggcgaccgactgagcggggcagcggcccggggcgac
gtgcaggaggtgcgccgccttctgcaccgcgagctgatgcaccccgacgccctgaaccgc
ttcggcaagacggcgctgcaggtcatgatgttcggcagtcccaccatcgccctggagctg
ctgaagcaaggggccagccccaacgtccaggatgtctctggcaccactccagcccacgat
gcagctcgcactggattcctggacaccctgaaggtcctagtggaacatggcgccgatgtc
aacacgcctgatggcaccggggcactcccaatccatctggcggtgcgggagggtcacgcc
gcggtggtcagcttcctggctgctgagtctgatctccatcaccgggacgccagggggctc
acgcccctggagctggcgcagcagagaggggctcgggacctcatggacatcctgcaaggg
cacttggtggccccactgtga

DBGET integrated database retrieval system