KEGG   Loxodonta africana (African savanna elephant): 100661392
Entry
100661392         CDS       T04351                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05219  Bladder cancer
lav05323  Rheumatoid arthritis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661392 (VEGFA)
   04014 Ras signaling pathway
    100661392 (VEGFA)
   04015 Rap1 signaling pathway
    100661392 (VEGFA)
   04370 VEGF signaling pathway
    100661392 (VEGFA)
   04066 HIF-1 signaling pathway
    100661392 (VEGFA)
   04020 Calcium signaling pathway
    100661392 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100661392 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100661392 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100661392 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661392 (VEGFA)
   05206 MicroRNAs in cancer
    100661392 (VEGFA)
   05205 Proteoglycans in cancer
    100661392 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100661392 (VEGFA)
   05211 Renal cell carcinoma
    100661392 (VEGFA)
   05219 Bladder cancer
    100661392 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100661392 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100661392 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100661392 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100661392 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661392 (VEGFA)
   05165 Human papillomavirus infection
    100661392 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100661392 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100661392 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100661392 (VEGFA)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100661392 (VEGFA)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100661392 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF Ribosomal_60s
Other DBs
NCBI-GeneID: 100661392
NCBI-ProteinID: XP_010585726
LinkDB
Position
Unknown
AA seq 490 aa
IFASHSPLKSGQRFGGVAPLLPQITSDFGNHQRENRGSKNAREKSKKRERRGQSARTSEL
REARSKVSDLLLGVTAGARREPSPFGSRIGPAALTDRLTDTAPRPSAHLLSGRRQTVDAA
ASRGQEPDPAPGGGVEGVGARGDALKLFVQLLGCSRSGGAVVRVGGAEPSGAGRSASSGR
EEPQPEEGEEEEEKEEEEEERGPRRLGARKPGSWTGEAVVCEDSAPAARAPQAGARALAP
GGRGARRGAEESGPPRSPIRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQ
AAPTAEGGEPKSHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGG
CCNDEGLECVPTQDFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKEKARQEKKSVR
GKGKGQKRKRKKSRYKSWRVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 1473 nt   +upstreamnt  +downstreamnt
atttttgcttcccactccccacttaaatcgggccaacggtttgggggggttgctcctcta
ctcccccagatcacttcggattttggaaaccatcagagagagaacagaggtagcaagaac
gccagagagaagtcgaagaagagagagagacggggtcagagcgcacgaacaagcgagcta
cgagaggcacggagcaaagtgagtgacctgcttttgggggtgaccgccggagcgcggcgt
gagccctcccccttcggatcccgcatcggaccagcagcgctgacggacagactgacagac
accgccccccgccccagcgcccacctcctctctggccggcggcagacggtggacgcggcg
gcgagccgcgggcaggagccggatcccgcgcccggaggcggggtggagggggtcggggct
cgcggtgatgcactgaaacttttcgtccaacttctgggctgttctcgctcgggaggagcc
gtggtccgcgtcgggggagcggagccgagcggagccgggagaagtgctagctccggccgg
gaggagccgcagccggaggagggggaggaggaagaggagaaggaagaggaggaggaggag
agggggccgcggcggctcggcgctcggaagccgggctcatggacgggtgaggcggtcgtg
tgcgaagacagtgccccagccgcgcgtgctccccaggccggtgccagggccttggctcca
ggaggaagaggagcccgccgaggcgccgaggagagcgggccgccccgcagcccgatcagg
agagggagcgcgagccgcgccggccccggtcgggcctccgaaaccatgaactttctgctc
tcctgggtgcattggagccttgccttgctgctctacctccaccatgccaagtggtcccag
gctgcacccaccgcagaaggaggagagccgaaatcccatgaagtggtgaagttcatggac
gtctaccaacgcagctactgccgtccaattgagaccctggtggacatcttccaggagtat
cctgatgagatcgagtacatcttcaagccgtcctgtgtgcccctgatgcggtgtgggggc
tgctgcaacgatgaaggcctagagtgcgtgcccactcaggacttcaacatcactatgcag
attatgcggattaaacctcaccaaggccagcacataggagagatgagcttcctacagcac
agcaaatgtgaatgcagaccaaagaaagaaaaagcaagacaagaaaaaaaatcagttcga
ggcaaggggaaggggcaaaaacgaaagcgcaagaaatcccggtataaatcctggagagtt
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system