KEGG   Loxodonta africana (African savanna elephant): 100661448
Entry
100661448         CDS       T04351                                 

Gene name
GORAB
Definition
(RefSeq) RAB6-interacting golgin
  KO
K19748  RAB6-interacting golgin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100661448 (GORAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100661448 (GORAB)
Membrane trafficking [BR:lav04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100661448 (GORAB)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 100661448
NCBI-ProteinID: XP_010593269
LinkDB
Position
Unknown
AA seq 373 aa
MAQAWAGFSEEELRRLKQTKDPFEPQRRRPTNKSRQQLLREKALQEQSQKLGLQDGSTSL
PLEQLLSVPKQRFNTQKPCSSLPAPSVARTSPIGDEKQQGTESQSREVGLENSHDVNLNK
KVEVPPPKPDCKLEKKKMELQEKSRWEVLQREQRLMEEKNKRKKALLAKAIAERSKRTQA
ETMKLKRIQKELQALDDMVSTDIGILRNRIDQASLDYSYARKRFDKAEAEYVAAKLDLQR
KTEIKEQLTEHLCTIIQQNELRKAEKLEGLMQQLDVQADEEALALEAEVARLLQEQETEA
GKQTTGLEKLCHPSGDRATLEFPKENRKHQEQTASPKVDEQGESSNGSSLHSPDGQNQDT
KAAVGDTSAALPT
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggcgcaggcttgggcaggcttttctgaggaggagctgaggcggctaaagcagactaaa
gatccatttgaaccacagcggcgtcggcccacgaacaaaagtcgacaacaacttctgcga
gagaaagcccttcaagagcaaagccaaaaacttggacttcaagatggatcaacctcatta
cctctagaacagctgctttccgttccgaaacagagatttaatactcaaaaaccatgttct
tctcttcctgctccttctgtggcgcgcacctcccctattggtgatgaaaagcaacagggt
actgaaagtcagtcaagggaagtggggctcgagaattctcatgatgtaaacctcaataag
aaagtcgaggttccacctccaaagccagattgcaaattggagaaaaagaaaatggaattg
caagaaaaatctcgttgggaagtcctccaacgagaacaacggttaatggaagagaaaaat
aaacgtaagaaagctcttttggccaaagctattgcagaaagatctaaaagaactcaagca
gagaccatgaaattgaagcggatccagaaggagttacaagctttagatgacatggtgtcc
actgacattggaattctcaggaaccggatcgatcaggccagcctagactattcatatgcc
cggaagcggtttgacaaggccgaggcagagtatgttgcagcaaagctagatctccagcgc
aagactgaaattaaagagcagctcactgagcacctttgtacgatcatacagcagaatgag
ctccggaaggccgagaagttggaggggttgatgcagcagctggatgtacaagctgacgaa
gaggctttggcgcttgaggcggaggtggcgagattgctgcaggaacaagagacagaagcg
gggaaacagacgactggtttagagaagctgtgtcatccttctggggacagggcgacctta
gaatttcctaaagagaacagaaagcatcaagaacaaactgcttccccaaaggtagatgaa
cagggtgaaagttccaatggcagctcccttcatagtccagacggccaaaatcaagacact
aaagctgctgtaggtgacacttcagccgctctgcccacatga

DBGET integrated database retrieval system