KEGG   Loxodonta africana (African savanna elephant): 100661492
Entry
100661492         CDS       T04351                                 

Gene name
IKBKG
Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01523  Antifolate resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04920  Adipocytokine signaling pathway
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05212  Pancreatic cancer
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05340  Primary immunodeficiency
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661492 (IKBKG)
   04014 Ras signaling pathway
    100661492 (IKBKG)
   04064 NF-kappa B signaling pathway
    100661492 (IKBKG)
   04668 TNF signaling pathway
    100661492 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100661492 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100661492 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100661492 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100661492 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100661492 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100661492 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100661492 (IKBKG)
   04660 T cell receptor signaling pathway
    100661492 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100661492 (IKBKG)
   04659 Th17 cell differentiation
    100661492 (IKBKG)
   04657 IL-17 signaling pathway
    100661492 (IKBKG)
   04662 B cell receptor signaling pathway
    100661492 (IKBKG)
   04062 Chemokine signaling pathway
    100661492 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100661492 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100661492 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661492 (IKBKG)
   05203 Viral carcinogenesis
    100661492 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100661492 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100661492 (IKBKG)
   05221 Acute myeloid leukemia
    100661492 (IKBKG)
   05220 Chronic myeloid leukemia
    100661492 (IKBKG)
   05215 Prostate cancer
    100661492 (IKBKG)
   05222 Small cell lung cancer
    100661492 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100661492 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100661492 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100661492 (IKBKG)
   05135 Yersinia infection
    100661492 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100661492 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100661492 (IKBKG)
   05162 Measles
    100661492 (IKBKG)
   05164 Influenza A
    100661492 (IKBKG)
   05161 Hepatitis B
    100661492 (IKBKG)
   05160 Hepatitis C
    100661492 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100661492 (IKBKG)
   05163 Human cytomegalovirus infection
    100661492 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661492 (IKBKG)
   05169 Epstein-Barr virus infection
    100661492 (IKBKG)
   05165 Human papillomavirus infection
    100661492 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100661492 (IKBKG)
   05142 Chagas disease
    100661492 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100661492 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100661492 (IKBKG)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100661492 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ABC_membrane_2 LLC1
Other DBs
NCBI-GeneID: 100661492
NCBI-ProteinID: XP_023396514
LinkDB
Position
Unknown
AA seq 421 aa
MSKHPQKNPLCEMVQPSSGPAXDQDVLVEESSLGKSAMLHLPLEQGASEPLQRCLEENQE
LRDAFRESNQMLRERCEELLHFQVSQREEKEFLMQKFQEARKLVEKLSLEKLELKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAANKDLQALEGRARAASEQ
ARQLENEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQD
YDNHIKSSMASSERNRGIQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKTVMETVPV
LRAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASSQESARALIEDMRK
RHVEGPQPPLPPAQAHHSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDIDTLQIHVMECI
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgagcaagcatccccagaagaatccactttgtgagatggtgcagcccagtagtggtcca
gcgngggaccaggacgtgctggttgaagagtcttctctggggaagtcagccatgctccac
ctgcctttggagcagggtgcttccgagcccctccagcgctgtctggaggagaatcaggag
ctccgagatgcattccgggagagcaaccagatgctccgggagcgctgtgaggagctgctg
catttccaggtcagccagagagaggagaaggagttcctcatgcagaagttccaggaggcc
cggaaactggtagagaaactgagcctggagaagcttgagctgaagaggcagagagagcag
gccctgcaggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tcggtgaaagcccaggtgacgtcactgctaggggagctccaggagagccagagccgctta
gaggctgccaacaaggacctgcaggctttggagggcagggcccgggcggccagcgagcag
gccaggcagctggagaacgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgcactgcgcatggagcgtcaggccgcc
tcggaggagaagcggaagctggcccagttacaagtggcttatcaccagcttttccaagac
tatgacaatcacatcaagagcagcatggccagcagtgagcgaaaccgaggcatccagctg
gaagatttgaagcagcagctgcagcaggctgaggaggccctggtggccaagcaggagctg
atcgacaagctgaaggaggaggcggagcagcacaagacagtgatggagacggtccccgtg
ctcagggcccaggcggatatctacaaagcggactttcaggctgagaggcaggcccgggaa
aagctagccgagaagaaggagctgctgcaggagcagttggagcagctgcagagggagtac
agcaaactgaaggccagctcgcaggagtcagccagggctctgattgaggatatgcggaag
cggcatgtcgagggcccccagccacctttgcctcctgcccaagctcatcactcctttcac
ctggccctgcctagccagaggagaagcccccccgaggagccacctgatttctgttgtccc
aagtgccagtatcaggctccggatatcgacaccctgcagatacatgtcatggagtgcatt
gagtag

DBGET integrated database retrieval system