KEGG   Loxodonta africana (African savanna elephant): 100661555Help
Entry
100661555         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme-like protein Ace3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04614  Renin-angiotensin system
lav04924  Renin secretion
lav05142  Chagas disease (American trypanosomiasis)
lav05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:lav00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100661555
   04614 Renin-angiotensin system
    100661555
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100661555
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100661555
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100661555
Peptidases [BR:lav01002]
 Metallo Peptidases
  Family M2
   100661555
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100661555
CD molecules [BR:lav04090]
 Proteins
  100661555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 PAS_9 PAS_8 PAS_3 PAS PAN_3
Motif
Other DBs
NCBI-GeneID: 100661555
NCBI-ProteinID: XP_023409204
LinkDB All DBs
Position
Unknown
AA seq 852 aa AA seqDB search
MSYNESEAKEFLQNYEQTAQFVWNNFMEATWNYVTNITKKNREEMLLKDMERSQHILYFG
TQARLFNITTFQDPVIKRMLRKVQNMGKAVLPVEELQEYNQLLAYMKTMYSMAEVCLEEG
PCLYLEPDLEEVMATSRDQKELLWAWQGWRDAAGRPLRTFFERYVQLSNKAANLNGYKDM
GALWRSKYDSENETSTLEGDLELLFQELQPLYLNLHAYVRRALYRHYGPQLIDLKGPIPA
HLLGDMWAQSWVNILDLVLPFPEKPLEDITKIMKGQRWKPHKMFQEAEKFFTSLGLLPAP
MEFWSKSMLEKPADGREVMCHASAWDFYNGHDFRIKKCTEVSIEDLLSVFHLMGHIQYFL
QYKSLSVIFREGANPAFEEAVGSAITLSASSHKYLLNIGLLSLVFQDSKDEVNFLMGIAL
EKIAFIPFGYLVDLYRWKVFDGTIHKDIYTQEWWRLRLKYQGLCPPIPRSEEDFDPGAKY
HISASIPYLRYFLSVVLQFQLHEALCRAAGHMGPLHRCNIYNSKMAGKLLEDALKLGSSK
PWPEVLKMLTGESHVSTKALMTYFKPLMNWLVTENVRQGEVLGWPEFSCSFEEKEKSTFL
GLELDSDQAKMGQWVLLVLSLVMFLMVLILGRRLYTLSTAQDTEAYFLGMAMEPNKAARG
QWILLGLCVLLLVCSISLTIKIFTQYSKKPPWMTADWPRTTAPPPTSQDPPLPGPVQEKL
PPPRPASPQPPPPPPTPLVSAPWRGQFPVGLGWEEVRGAVTGEGGEAKAGRKFLIANAQM
ENCAIIYCNDGFCELFGYSRVEVMQRPCTCDFLTGPNTPRSAMSRLAQALLGAEECKVDI
LYYRKDGEAPSA
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaacgagagtgaagcaaaggaattccttcagaattatgaacaaacagcccag
tttgtatggaacaacttcatggaggctacctggaactatgtcaccaacatcaccaagaaa
aaccgagaggagatgctgctcaaagacatggagagatcccagcatatcctatactttggc
acccaagcccgcctgtttaacatcaccacattccaggacccagtcataaagcgcatgctg
agaaaggtccaaaacatgggcaaggcagttctgcctgtggaagaactccaggagtacaac
cagctcctggcctacatgaagacgatgtacagtatggcggaggtgtgccttgaagagggg
ccctgcctgtacctggagcctgaccttgaagaagtgatggccacctcccgggaccagaaa
gagctgctgtgggcgtggcagggctggcgggacgctgcaggccgcccactccgcaccttc
ttcgagcgctatgtgcaactcagcaacaaggccgcaaacctcaatggttacaaagacatg
ggggccttgtggcgctcaaagtatgactctgagaatgagaccagcaccctggaaggcgac
ctggagctgttgttccaggagcttcagccgctgtacctgaacctgcatgcctacgtgcgc
cgtgccttgtaccgccattatgggccccagctcatcgacctgaaggggcccatccccgcc
cacctcctgggggacatgtgggctcagtcctgggtcaacatcttagacctggtcttgccc
ttcccggagaaacccctggaggacatcacgaagatcatgaaaggccagcgctggaagccc
cacaaaatgttccaagaggctgaaaaattcttcacctcccttgggctactgcctgcccca
atggaattctggagcaagtcgatgctggagaagccagctgatgggcgggaggtgatgtgc
catgcttctgcctgggacttctacaatggtcacgacttcaggataaagaagtgtaccgag
gtgagcatagaagacctgctctccgtcttccacctaatgggccatattcagtactttctg
cagtacaagagcctttctgtgatcttccgagaaggtgccaacccagcctttgaagaggct
gtggggtcagcgatcaccctctcagcctcctcccacaagtacctgctcaacataggcttg
ctcagcttagtgttccaggactcaaaggacgaggtcaatttcctgatgggcattgccctg
gagaagattgccttcatcccctttggctacctggtggacctgtaccgctggaaggtattt
gatggcaccatccataaggacatctatacccaggagtggtggcgcctgaggttgaagtac
cagggcctgtgcccccccattcctcggtcagaagaggactttgatccaggtgccaagtac
cacatttctgccagcattccctacttaaggtactttctcagcgtggtgctccagttccag
ctccatgaagcactgtgcagagccgccggccacatgggtccgctgcaccggtgtaacatc
tataactccaagatggctggaaagctcctagaggatgctctaaagctgggttcaagcaag
ccctggccagaagtcctgaagatgctgaccggggagtcccacgtgtctacaaaggccctc
atgacctacttcaagcccctgatgaactggctggtcaccgagaatgtgcggcagggggag
gtcctgggctggccagaattcagctgttcctttgaagaaaaagagaagagcacattcctg
ggtctggagctggacagtgaccaggccaagatggggcaatgggtgctgctggtcttgagc
cttgtcatgttcctcatggttctaatactgggccgcaggctatacactctgtcaacagcc
caggacactgaggcttacttcctgggcatggccatggagcccaacaaggctgcccggggc
cagtggatattgctgggcctctgtgtcctcctgctggtgtgctcaatcagcctgaccatc
aagattttcacacagtacagcaagaagcccccatggatgacagctgactggcccaggacc
accgccccgccccctacgagtcaggacccgcccctgcccggtccagtccaggagaagttg
cccccaccccgcccggcctccccgcagccgccgccgccgccgcccacacctcttgtttca
gcaccgtggcgcggacagttcccggtcgggctaggttgggaggaggtgcggggagcggtg
accggggagggcggggaggccaaggcaggtcgtaagttcctgattgccaacgctcagatg
gagaactgcgccatcatttactgcaatgacggcttctgtgaactctttggctattcccgc
gtggaggtgatgcagcggccgtgcacctgcgacttcctcacaggccctaacaccccgcgc
agtgccatgtcccgcctggcacaggccctgctgggggccgaggagtgcaaggtggatatc
ctctactaccgcaaggatggtgaggcaccctctgcatga

DBGET integrated database retrieval system