KEGG   Loxodonta africana (African savanna elephant): 100661599Help
Entry
100661599         CDS       T04351                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00052  Galactose metabolism
lav01100  Metabolic pathways
lav04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100661599 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100661599 (LCT)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     100661599 (LCT)
    3.2.1.108  lactase
     100661599 (LCT)
Chaperones and folding catalysts [BR:lav03110]
 Intramolecular chaperones
  Others
   100661599 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 100661599
NCBI-ProteinID: XP_003405907
LinkDB All DBs
Position
Unknown
AA seq 1931 aa AA seqDB search
MPFSSSLKMKLPWNLVFIVLLSSSCWGFDWECDRNFISAAGPLTNDLLHNLNSQLGNQGY
NVAAGDKDIYVCHQSLPAFLPEYFSSIHASQVTHYKVFLPWAQLLPTGSSKNPDEKIVQC
YRRLLEALKTAQLQPIVILHNQTLPASIVQGSQAFADLFADYAAFAFHSFGDLVGIWFTF
SDLNKAITELPYQESKASRLQTLTDAHRKACEIYHQTFASQGGKLSVVLPAEEIAELLLE
PSMTALAKDLVSFLSLDLSLACQSEVNLSQELSKFQAIEPKVKVFIFNLKLQDCPSSRTA
RLLFSLIEAMNKDQVLIIGFDINAFLNCTASSRSCSLINDLTLQADQQQDCKTAVGSSSP
VSAYQRVWEMFANQSRAERDAFLWDVFPEGFLWGVSTGAFNVEGGWAEDGRGPSVWDRHG
NQKATEGQATPEVASDSYHKVESDVALLRGFRAQVYKFSISWSRIFPTGHSSSPSPQGVA
YYSKLIDSLLDSHIEPMVTLFHWDLPQALQDGGGWQNESVVDAFLDYAAFCFSTFGDRVK
LWVTFHEPWVMSYAGYGTGQHAPGISDPGVASFKVAHLVLKAHARAWHHYNSHHRLQQQG
HVGIVLNSDWAEPLSPERPEDLRASEHFLHFMLGWFAHPIFVDGDYPAALRAQIQQRNKQ
CPQPVAQLPEFTEAEKQLLKGSADFLGLSHYTSRLISRAQQNTCIPSYDAIGGFSQHVDP
AWPRTSSPWIRVVPWGIRRLLKFVSLEYTRGNVPIYLAGNGMPIDGCKNLFNDSLRVDYF
NQYINEVLKAVKEDSVDVRSYIVRSFIDGFEGPSGYSQKFGLHYVNFNDSSKPRTPRRSA
YFFTSIIEKNGFLTKVANWLPPPITPNVPPKIRAFAFPSEVPSKAKVVWEKFSNQPKFER
DLFYHGTFRDDFLWGVSSSAYQIEGGWNADGKGPSIWDNFTHTPGNNVKDNSTGDIACDS
YNQLDADLNILRALKVKAYRFSLSWSRIFPTGRNSSINSYGVDYYNKLINGLVASNISPM
VTLFHWDLPQALQDIGGWDNPSLIELFDSYADFCFQTFGDRVKFWMTFNEPMYQAWLGYG
SGEFPPMMKDPGWAPYRVGHAVIKAHARVYHTYDEKYRQKQKGVISLSLSTHWAEPKSPG
VPRDVEAADRMLQFSIGWFAHPIFRNGDYPDAMKWTVGNRSELQHLATSRLPSFTEEEKR
YIRATADVFCLNTYYSRIVQHKTPALNPPSYEDDQEIVEEEDPSWPSTAMNRAVPWGMRR
LLNWIKEEYGDIPIYVTENGVGLANPELEDTDRIFYHKTYINEALKAYRLDGVDLRGYVA
WSLMDNFEWLNGYTVKFGLYHVDFNDPNRPRTARTSATYYTEVITNNGMPLPREDEFLYG
RFPDGFIWSAASAAYQIEGAWREDGKGLSIWDTFSHTPLKVENDDTGDMACDSYHKIAED
LAALRNLGVSHYRFSVSWSRVLPDGTTRYINEAGLDYYLRLIDALLAADIKPQVTIYHWD
LPQALQDVGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPFIIANQGYGYGTAAPG
ISLRPGTAPYVVGHNLIKAHAEAWHLYNDVYRTTQGGIISITINSDWAEPRNPSNQEDVE
AAKRFLQFTAGWFAHPIFKNGDYNEVMKTRILDRSLAAGLSKSRLPEFTESEKRRINGTY
DFFGFNHYTTVLAYNLNSDSSISYDADRGVASHTDRSWPVSGSSWLKMTPFGFRRILNWI
KEEFNNPPIYITENGVSQQGEVNLNDTERVYYLRSYINEALKAVQDKVDIRGYTAWSVMD
NFEWAAGFAERFGLHFVNYTDPSLPRIPKESAKFYASVVRCNGFLDPAAGPHPCLQWEDA
VPTVSPMRKEGVSFLGLTLGPAEAQTALYTLFSLVLLGVCIVAFLSYKCCKRSKQKETQP
GQQELSACSSF
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atgccttttagcagttccttgaaaatgaagctgccttggaatttagtcttcatcgtgctc
ttaagttcttcatgctgggggtttgactgggagtgtgatagaaatttcatttcagctgct
ggtcctctaaccaatgacttgctgcacaacctgaacagccaactgggaaaccagggctat
aatgttgctgcaggtgacaaggacatttatgtttgtcaccagtcactgcctgctttcctg
ccagagtactttagcagtattcatgccagtcaggttacccattataaagtatttctgcca
tgggcacagcttcttccaacaggaagctccaagaatccagacgagaaaatagtgcagtgc
taccggagactcctagaggccctgaagaccgcacagcttcagcccattgtcatcctgcac
aaccagacactacccgccagcattgtccagggaagccaagcctttgctgacctctttgct
gactatgccgcattcgccttccactcctttggggacctagttgggatctggttcactttt
agtgacctgaacaaggcaataacggaacttccctatcaggaatcaaaagcttcacgtctc
cagactctcacagatgcgcacagaaaagcctgtgagatttaccaccaaacgtttgcttct
cagggtggaaagctttctgtagttcttccagctgaagagatcgctgagctcctgctagaa
ccatccatgactgcgcttgccaaggacttggtcagtttcctctctcttgatttgtccctt
gcatgccaaagtgaggtgaatttatcacaggagctgagtaaatttcaggccattgagccc
aaagtgaaagttttcatcttcaacctaaaactccaggactgcccctcctccaggaccgcc
aggctgctcttcagcctgatagaagccatgaataaagaccaagtgctcatcattggattt
gatattaatgcattcctgaactgtacagcaagcagcaggtcttgttctttgattaacgac
ctgacccttcaggctgaccagcaacaggactgcaagacagccgttggctcctcttctcct
gtctctgcctaccagagggtctgggaaatgtttgcgaaccagtccagagcagagagggac
gctttcctgtgggacgtttttcctgaaggctttctctggggagtttccacaggagccttt
aatgtggaaggaggctgggctgaagacggaaggggtccaagcgtctgggaccgacatgga
aaccagaaagccactgagggccaagcaacaccggaggtggccagtgacagttaccacaag
gtggaatctgatgtggccctgcttcgtggcttccgggctcaagtctacaagttttccatc
tcctggtcccggatcttccccactgggcacagtagcagccccagcccccaaggtgtcgcc
tactacagcaagctgatcgacagcctgctggactctcacattgaacccatggtgaccctg
ttccactgggacctgccccaggccctgcaggatggtggcgggtggcagaacgagagtgtg
gtggatgccttcctggactatgcggccttctgcttctctacttttggagaccgtgtgaag
ctgtgggtgacctttcatgagccatgggttatgagctatgcaggttatggcaccggccaa
catgcaccaggcatctctgacccaggagtggcctcttttaaggtagctcacttggtcctc
aaggctcatgccagagcttggcaccactacaacagccatcatcgcctgcagcagcagggg
catgtgggcattgtgctgaactcagactgggcagaacccttgtccccagagaggcccgag
gacctaagggcttctgagcatttcttgcacttcatgctgggctggtttgcacaccccatc
tttgtggatggtgactacccagctgccctgagagcccagatccaacaaaggaacaaacag
tgcccccagcctgtggcccagctccctgagttcactgaggcagaaaagcagttgctgaaa
ggatcagctgactttctgggtctgtcccattacacctcccgcctcatcagtcgtgcccag
caaaacacctgcattcccagctatgatgccatcggaggcttctcccaacatgtggaccct
gcgtggcctcggacctcatccccttggattcgtgtggttccctggggtataaggaggctg
ttgaagtttgtatccttggaatacacaagaggaaatgttccaatctacctggctgggaat
ggcatgcccatagacggatgtaaaaatctctttaatgactccttgagagtagactacttt
aatcagtatatcaatgaggtactcaaagctgtcaaggaggactctgtggatgttcgttct
tacattgttcgttccttcattgatggctttgaaggcccctctggctacagtcagaagttt
gggctgcactatgtcaactttaacgacagcagcaagccaaggactcccaggagatctgcc
tactttttcaccagcatcattgaaaagaatggtttcctcactaaggtagcaaactggctg
ccaccacctattacgccaaatgtcccccctaaaattagggccttcgcttttccatctgag
gtaccctccaaggctaaagtagtttgggaaaagttctcaaaccaacccaagttcgaaaga
gatttgttctaccatggcacatttcgggatgactttctgtggggcgtgtcctcttcagca
tatcagattgaaggaggttggaatgccgatggcaaaggccccagcatttgggataacttt
acgcacacaccagggaataatgtgaaagacaacagcactggagacatagcttgtgacagc
tataaccaattggatgccgatctgaatatactccgagctttgaaggtgaaggcctatcgc
ttttctctctcctggtctcgaattttcccaactgggagaaacagttctatcaacagttac
ggtgtggattattacaacaagttgatcaatggcttggtggcaagtaacatctctcccatg
gtgaccctattccactgggacctgccacaagccctccaggatattggaggctgggataat
ccttccttgattgagttgtttgacagctatgcggacttttgtttccagacctttggtgac
agagtcaagttctggatgacctttaatgagcccatgtaccaggcatggttgggttatggc
tcaggggaatttcctccaatgatgaaggacccaggatgggcaccttatagggttggccat
gctgtcatcaaagctcatgccagagtctatcacacatatgatgagaagtataggcagaaa
cagaagggagtgatttcactgagcctcagtacacactgggcagagcccaagtcgccagga
gtcccacgagacgtggaagcagctgaccgaatgctccagttttccatcggctggtttgcc
caccccatcttcagaaatggagactatcctgatgccatgaagtggacagtggggaacagg
agtgaactacaacacttggccacctcccgcctgccaagcttcactgaggaagagaagagg
tatattagggccacggccgacgtcttctgcctcaacacctactactccaggatcgtgcag
cacaaaacacccgcgctaaacccaccttcctatgaagatgaccaggagatagtcgaggag
gaggacccttcatggccttccacggccatgaacagagctgtgccctggggcatgcgtaga
ctgctgaactggatcaaagaagagtatggtgacatcccaatttacgttactgaaaatgga
gtggggctggcaaatccagaattggaggacactgataggatattttatcataaaacctat
atcaatgaagctttgaaagcctacaggcttgatggtgtagatcttcgaggatatgtggca
tggtctctgatggacaactttgaatggctaaatggctacacagtcaagtttggactgtac
catgttgatttcaacgacccgaacaggcctcgaacagcaagaacctccgctacatactac
acagaggtcattaccaacaacggcatgccgctgcccagggaagacgagtttttgtatgga
cggtttcccgatggcttcatctggagtgcagcttctgctgcatatcagattgaaggtgcg
tggagagaggatggcaagggactcagcatctgggatacattttcccacacacctctgaaa
gtggagaatgatgacactggagacatggcctgtgacagttatcacaagattgccgaggat
ctggcagccctgcggaacctgggcgtgtctcactaccgcttttccgtctcctggtcccgc
gtcctcccggatggaaccaccaggtacatcaacgaggccggcctggactattacctgcgg
ctcattgacgcactgctggctgccgacatcaagccccaggtgaccatttaccactgggac
ctgccgcaggcgctgcaggatgttggcggctgggagaatgagaccattgtccagcggttt
aaagagtacgcagatgtgctcttccagaggctgggagacaaggtgaagttttggatcaca
ctgaatgaaccctttatcattgctaaccagggctatggctacgggacagcagctccagga
atctccttaaggcctggcactgccccctatgttgttggccacaaccttataaaggcgcat
gctgaagcctggcatctgtataatgacgtgtaccgtaccactcaaggtggcatcatttcc
atcaccatcaacagcgactgggctgagcctagaaacccctccaaccaggaggatgtggag
gcagccaagagattccttcagtttacagcaggctggtttgcacatcctatcttcaagaac
ggagattacaatgaggtgatgaagacccggatcctcgacaggagcttggccgcaggcctc
agcaagtctcggctccccgagtttactgagagtgagaagaggaggatcaacggcacctat
gactttttcgggttcaatcactacaccactgtcctggcctacaacctcaactctgattct
tcgatctcctatgatgcagacaggggagttgcttcccatacagatcgatcttggccagtc
tctggctcctcctggttaaagatgacaccttttggcttcaggagaatcctgaactggata
aaggaggagttcaacaacccgccaatttatataacagagaatggagtgtcccagcaggga
gaagtaaacctcaacgacactgagagggtctactatctccgcagttatatcaatgaggca
ctcaaagctgtgcaggacaaggtggacattcgaggatacacagcctggagtgtgatggac
aacttcgagtgggccgcaggctttgctgagaggtttgggctacactttgtgaactacact
gacccttctctgccaaggatccccaaagagtcggccaagttctacgcctccgtagtccgg
tgcaatggcttccttgaccctgctgcagggcctcacccttgtctccagtgggaagatgcc
gttcccaccgtcagccccatgagaaaggagggagtttcattcctggggctaacactaggt
ccagcagaagcacaaacagctttatacacactcttttctctcgtgcttcttggagtctgt
attgtggcatttctttcatacaaatgctgtaagcgttctaagcaaaaggaaacacagcca
ggccaacaggaattgagtgcttgctcttcattctga

DBGET integrated database retrieval system